RegulonDB RegulonDB 10.9: Gene Form
   

yibN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gpmM yibN grxC Cra CRP terminator TSS_4200 TSS_4200 TSS_4199 TSS_4199 TSS_4198 TSS_4198 TSS_4197 (cluster) TSS_4197 (cluster) TSS_4196 (cluster) TSS_4196 (cluster) gpmMp gpmMp TSS_4195 (cluster) TSS_4195 (cluster) TSS_4194 (cluster) TSS_4194 (cluster) yibNp yibNp gpmMp2 gpmMp2 TSS_4193 TSS_4193 yibNp7 yibNp7 TSS_4192 (cluster) TSS_4192 (cluster) grxCp2 grxCp2 TSS_4191 TSS_4191 TSS_4190 TSS_4190 TSS_4189 TSS_4189 TSS_4188 TSS_4188 secBp secBp

Gene      
Name: yibN    Texpresso search in the literature
Synonym(s): ECK3601, EG12295, b3611
Genome position(nucleotides): 3784584 <-- 3785015 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.54
External database links:  
ASAP:
ABE-0011805
ECHOBASE:
EB2203
ECOLIHUB:
yibN
OU-MICROARRAY:
b3611
STRING:
511145.b3611
COLOMBOS: yibN


Product      
Name: putative sulfurtransferase YibN
Synonym(s): YibN, putative rhodanese-related sulfurtransferase
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 15.596
Isoelectric point: 10.101
Motif(s):
 
Type Positions Sequence
10 -> 31 RHPILSIAWIALLVAVLVTTFK
50 -> 143 NKEDAVVVDLRQRDDFRKGHIAGSINLLPSEIKANNVGELEKHKDKPVIVVDGSGMQCQEPANALTKAGFAQVFVLKEGVAGWAGENLPLVRGK
43 -> 133 GEATRLINKEDAVVVDLRQRDDFRKGHIAGSINLLPSEIKANNVGELEKHKDKPVIVVDGSGMQCQEPANALTKAGFAQVFVLKEGVAGWA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005887 - integral component of plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12295-MONOMER
ECOLIWIKI:
b3611
INTERPRO:
IPR001763
INTERPRO:
IPR036873
MODBASE:
P0AG27
PFAM:
PF00581
PRIDE:
P0AG27
PROSITE:
PS50206
REFSEQ:
NP_418068
SMART:
SM00450
SMR:
P0AG27
UNIPROT:
P0AG27


Operon      
Name: yibN-grxC-secB-gpsA         
Operon arrangement:
Transcription unit        Promoter
secB-gpsA
yibN-grxC-secB-gpsA
grxC
yibN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4188 3784234 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4189 3784239 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4190 3784506 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4191 3784513 reverse nd [RS-EPT-CBR] [1]
  promoter grxCp2 3784576 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4192 (cluster) 3785055 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter yibNp7 3785056 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4193 3785186 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4194 (cluster) 3785206 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4195 (cluster) 3785226 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4196 (cluster) 3785237 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4197 (cluster) 3785244 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4198 3785340 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4199 3785763 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4200 3786671 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB