RegulonDB RegulonDB 10.8: Gene Form
   

tmk gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mltG holB pabC ycfH tmk TSS_1420 TSS_1420 TSS_1419 TSS_1419 TSS_1418 TSS_1418

Gene      
Name: tmk    Texpresso search in the literature
Synonym(s): ECK1084, EG12302, b1098, ycfG
Genome position(nucleotides): 1155124 --> 1155765 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.05
External database links:  
ASAP:
ABE-0003714
ECHOBASE:
EB2208
OU-MICROARRAY:
b1098
PortEco:
tmk
STRING:
511145.b1098
COLOMBOS: tmk


Product      
Synonym(s): Tmk, YcfG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.783
Isoelectric point: 5.169
Motif(s):
 
Type Positions Sequence
147 -> 159 LKRARARGELDRI
8 -> 200 IEGLEGAGKTTARNVVVETLEQLGIRDMVFTREPGGTQLAEKLRSLVLDIKSVGDEVITDKAEVLMFYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKRARARGELDRIEQESFDFFNRTRARYLELAAQDKSIHTIDATQPLEAVMDAI
112 -> 112 G
122 -> 122 T
10 -> 17 GLEGAGKT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004798 - thymidylate kinase activity
GO:0009041 - uridylate kinase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0046940 - nucleoside monophosphate phosphorylation
GO:0009165 - nucleotide biosynthetic process
GO:0015949 - nucleobase-containing small molecule interconversion
GO:0016310 - phosphorylation
GO:0006233 - dTDP biosynthetic process
GO:0006235 - dTTP biosynthetic process
GO:0006227 - dUDP biosynthetic process
External database links:  
DIP:
DIP-48110N
ECOCYC:
DTMPKI-MONOMER
ECOLIWIKI:
b1098
INTERPRO:
IPR018094
INTERPRO:
IPR027417
INTERPRO:
IPR039430
INTERPRO:
IPR018095
MINT:
MINT-1258134
MODBASE:
P0A720
PANTHER:
PTHR10344:SF4
PDB:
4TMK
PDB:
1E9F
PDB:
5TMP
PFAM:
PF02223
PRIDE:
P0A720
PROSITE:
PS01331
REFSEQ:
NP_415616
SMR:
P0A720
UNIPROT:
P0A720


Operon      
Name: pabC-mltG-tmk-holB-ycfH         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1418 1155058 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1419 1156471 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1420 1156478 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB