RegulonDB RegulonDB 10.8: Gene Form
   

ycfH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ptsG holB ycfH tmk Fis ArcA Mlc Fis CRP ArcA Fis ArcA SoxS CRP Fis Fis Mlc SgrS TSS_1432 (cluster) TSS_1432 (cluster) TSS_1431 TSS_1431 TSS_1430 TSS_1430 TSS_1429 (cluster) TSS_1429 (cluster) TSS_1428 TSS_1428 TSS_1427 TSS_1427 TSS_1426 (cluster) TSS_1426 (cluster) TSS_1425 (cluster) TSS_1425 (cluster) TSS_1424 TSS_1424 TSS_1423 TSS_1423 ptsGp1 ptsGp1 TSS_1421 TSS_1421 ptsGp2 ptsGp2 TSS_1420 TSS_1420 TSS_1419 TSS_1419

Gene      
Name: ycfH    Texpresso search in the literature
Synonym(s): ECK1086, EG12303, b1100
Genome position(nucleotides): 1156777 --> 1157574 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.88
External database links:  
ASAP:
ABE-0003719
ECHOBASE:
EB2209
OU-MICROARRAY:
b1100
PortEco:
ycfH
STRING:
511145.b1100
COLOMBOS: ycfH


Product      
Name: putative metal-dependent hydrolase YcfH
Synonym(s): YcfH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.809
Isoelectric point: 5.067
Motif(s):
 
Type Positions Sequence
4 -> 255 VDSHCHLDGLDYESLHKDVDDVLAKAAARDVKFCLAVATTLPGYLHMRDLVGERDNVVFSCGVHPLNQNDPYDVEDLRRLAAEEGVVALGETGLDYYYTPETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDCGGVLHCFTEDRETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYMAVLKGVAVEELAQVTTDNFARLFH
97 -> 97 L

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016788 - hydrolase activity, acting on ester bonds
GO:0004536 - deoxyribonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016888 - endodeoxyribonuclease activity, producing 5'-phosphomonoesters
biological_process GO:0006259 - DNA metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48157N
ECOCYC:
EG12303-MONOMER
ECOLIWIKI:
b1100
INTERPRO:
IPR018228
INTERPRO:
IPR032466
INTERPRO:
IPR015991
INTERPRO:
IPR001130
MINT:
MINT-1267935
MODBASE:
P0AFQ7
PANTHER:
PTHR10060
PDB:
1YIX
PFAM:
PF01026
PRIDE:
P0AFQ7
PROSITE:
PS01091
PROSITE:
PS01137
REFSEQ:
NP_415618
SMR:
P0AFQ7
SWISSMODEL:
P0AFQ7
UNIPROT:
P0AFQ7


Operon      
Name: pabC-mltG-tmk-holB-ycfH         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1419 1156471 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1420 1156478 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1421 1157737 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1423 1158280 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1424 1158634 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1425 (cluster) 1158640 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1426 (cluster) 1158878 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1427 1158897 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1428 1158901 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1429 (cluster) 1158904 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1430 1158907 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1431 1159132 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1432 (cluster) 1159175 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB