RegulonDB RegulonDB 10.7: Gene Form
   

sapD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sapD sapB sapC sapF sapA TSS_1736 TSS_1736 TSS_1735 TSS_1735 sapFp5 sapFp5 ycjDp5 ycjDp5 ycjDp4 ycjDp4

Gene      
Name: sapD    Texpresso search in the literature
Synonym(s): ECK1286, EG12304, b1291, trkE
Genome position(nucleotides): 1352636 <-- 1353628 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.36
External database links:  
ASAP:
ABE-0004342
ECHOBASE:
EB2210
OU-MICROARRAY:
b1291
PORTECO:
sapD
REGULONDB:
b1291
STRING:
511145.b1291
M3D: sapD
COLOMBOS: sapD
PortEco: b1291


Product      
Name: putrescine ABC exporter ATP binding protein SapD
Synonym(s): SapD, TrkE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 37.661
Isoelectric point: 9.297
Motif(s):
 
Type Positions Sequence
46 -> 46 K
165 -> 165 Q
179 -> 186 LLIADEPT
24 -> 187 DRVSMTLTEGEIRGLVGESGSGKSLIAKAICGVNKDNWRVTADRMRFDDIDLLRLSARERRKLVGHNVSMIFQEPQSCLDPSERVGRQLMQNIPAWTYKGRWWQRFGWRKRRAIELLHRVGIKDHKDAMRSFPYELTEGECQKVMIAIALANQPRLLIADEPTN
183 -> 183 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0015489 - putrescine transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006811 - ion transport
GO:0006813 - potassium ion transport
GO:0015833 - peptide transport
GO:0015847 - putrescine transport
GO:0071805 - potassium ion transmembrane transport
Note(s): Note(s): ...[more].
Evidence: [AUPEINH] Assay of unpurified protein expressed in its native host
[IGI] Inferred from genetic interaction
[IMP] Inferred from mutant phenotype
Reference(s): [1] Corratge-Faillie C., et al., 2010
[2] Dosch DC., et al., 1991
[3] Harms C., et al., 2001
External database links:  
DIP:
DIP-10825N
ECOCYC:
SAPD-MONOMER
ECOLIWIKI:
b1291
INTERPRO:
IPR013563
INTERPRO:
IPR027417
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MINT:
MINT-1271696
MODBASE:
P0AAH4
PFAM:
PF00005
PFAM:
PF08352
PRIDE:
P0AAH4
PRODB:
PRO_000023907
PROSITE:
PS50893
PROTEINMODELPORTAL:
P0AAH4
REFSEQ:
NP_415807
SMART:
SM00382
SMR:
P0AAH4
UNIPROT:
P0AAH4


Operon      
Name: sapABCDF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycjDp4 1351866 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ycjDp5 1351896 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter sapFp5 1352657 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_1735 1353593 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1736 1353743 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Corratge-Faillie C., Jabnoune M., Zimmermann S., Very AA., Fizames C., Sentenac H., 2010, Potassium and sodium transport in non-animal cells: the Trk/Ktr/HKT transporter family., Cell Mol Life Sci 67(15):2511-32

 [2] Dosch DC., Helmer GL., Sutton SH., Salvacion FF., Epstein W., 1991, Genetic analysis of potassium transport loci in Escherichia coli: evidence for three constitutive systems mediating uptake potassium., J Bacteriol 173(2):687-96

 [3] Harms C., Domoto Y., Celik C., Rahe E., Stumpe S., Schmid R., Nakamura T., Bakker EP., 2001, Identification of the ABC protein SapD as the subunit that confers ATP dependence to the K+-uptake systems Trk(H) and Trk(G) from Escherichia coli K-12., Microbiology 147(Pt 11):2991-3003

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB