RegulonDB RegulonDB 10.7: Gene Form
   

sapF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sapD sapF ycjD terminator TSS_1735 TSS_1735 sapFp5 sapFp5 ycjDp5 ycjDp5 ycjDp4 ycjDp4

Gene      
Name: sapF    Texpresso search in the literature
Synonym(s): ECK1285, EG12305, b1290
Genome position(nucleotides): 1351828 <-- 1352634 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.18
External database links:  
ASAP:
ABE-0004339
ECHOBASE:
EB2211
OU-MICROARRAY:
b1290
PORTECO:
sapF
REGULONDB:
b1290
STRING:
511145.b1290
M3D: sapF
COLOMBOS: sapF
PortEco: b1290


Product      
Name: putrescine ABC exporter ATP binding protein SapF
Synonym(s): SapF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 30.57
Isoelectric point: 9.809
Motif(s):
 
Type Positions Sequence
31 -> 178 KPLSFTLREGQTLAIIGENGSGKSTLAKMLAGMIEPTSGELLIDDHPLHFGDYSFRSQRIRMIFQDPSTSLNPRQRISQILDFPLRLNTDLEPEQRRKQIIETMRMVGLLPDHVSYYPHMLAPGQKQRLGLARALILRPKVIIADEAL
47 -> 54 GENGSGKS
6 -> 251 LEVRNLSKTFRYRTGWFRRQTVEAVKPLSFTLREGQTLAIIGENGSGKSTLAKMLAGMIEPTSGELLIDDHPLHFGDYSFRSQRIRMIFQDPSTSLNPRQRISQILDFPLRLNTDLEPEQRRKQIIETMRMVGLLPDHVSYYPHMLAPGQKQRLGLARALILRPKVIIADEALASLDMSMRSQLINLMLELQEKQGISYIYVTQHIGMMKHISDQVLVMHQGEVVERGSTADVLASPLHELTKRLI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0015489 - putrescine transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0015847 - putrescine transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35903N
ECOCYC:
SAPF-MONOMER
ECOLIWIKI:
b1290
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR017871
INTERPRO:
IPR027417
MODBASE:
P0AAH8
PFAM:
PF00005
PRIDE:
P0AAH8
PRODB:
PRO_000023908
PROSITE:
PS50893
PROSITE:
PS00211
PROTEINMODELPORTAL:
P0AAH8
REFSEQ:
NP_415806
SMART:
SM00382
SMR:
P0AAH8
UNIPROT:
P0AAH8


Operon      
Name: sapABCDF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycjDp4 1351866 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycjDp5 1351896 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter sapFp5 1352657 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1735 1353593 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB