RegulonDB RegulonDB 10.8: Gene Form
   

yfhH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfhH pgpC yfhL NsrR yfhHp5 yfhHp5 pgpCp pgpCp TSS_2853 TSS_2853

Gene      
Name: yfhH    Texpresso search in the literature
Synonym(s): ECK2559, EG12308, b2561
Genome position(nucleotides): 2698759 --> 2699607 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.71
External database links:  
ASAP:
ABE-0008428
ECHOBASE:
EB2214
OU-MICROARRAY:
b2561
PortEco:
yfhH
STRING:
511145.b2561
COLOMBOS: yfhH


Product      
Name: putative DNA-binding transcriptional regulator YfhH
Synonym(s): YfhH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.707
Isoelectric point: 9.107
Motif(s):
 
Type Positions Sequence
125 -> 265 CVTMLRSARRIILTGIGASGLVAQNFAWKLMKIGFNAAAVRDMHALLATVQASSPDDLLLAISYTGVRRELNLAADEMLRVGGKVLAITGFTPNALQQRASHCLYTIAEEQATNSASISACHAQGMLTDLLFIALIQQDLE
37 -> 56 SQQLANEAGVSQSSVVKFAQ
1 -> 77 MNGLLRIRQRYQGLAQSDKKLADYLLLQPDTARHLSSQQLANEAGVSQSSVVKFAQKLGYKGFPALKLALSEALASQ
128 -> 258 MLRSARRIILTGIGASGLVAQNFAWKLMKIGFNAAAVRDMHALLATVQASSPDDLLLAISYTGVRRELNLAADEMLRVGGKVLAITGFTPNALQQRASHCLYTIAEEQATNSASISACHAQGMLTDLLFIA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0097367 - carbohydrate derivative binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:1901135 - carbohydrate derivative metabolic process
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[HIFS] Human inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-12050N
ECOCYC:
EG12308-MONOMER
ECOLIWIKI:
b2561
INTERPRO:
IPR001347
INTERPRO:
IPR036388
INTERPRO:
IPR035472
INTERPRO:
IPR000281
INTERPRO:
IPR009057
MODBASE:
P37767
PFAM:
PF01380
PFAM:
PF01418
PRIDE:
P37767
PROSITE:
PS51071
PROSITE:
PS51464
REFSEQ:
NP_417056
SMR:
P37767
UNIPROT:
P37767


Operon      
Name: yfhH         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2853 2698592 reverse nd [RS-EPT-CBR] [3]
  promoter yfhHp5 2698707 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB