RegulonDB RegulonDB 10.8: Gene Form
   

pepB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pepB sseB iscX ryfA terminator TSS_2824 TSS_2824 TSS_2823 TSS_2823

Gene      
Name: pepB    Texpresso search in the literature
Synonym(s): ECK2520, EG12310, b2523, yfhI
Genome position(nucleotides): 2655075 <-- 2656358 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.85
External database links:  
ASAP:
ABE-0008305
ECHOBASE:
EB2216
OU-MICROARRAY:
b2523
PortEco:
pepB
STRING:
511145.b2523
COLOMBOS: pepB


Product      
Name: aminopeptidase B
Synonym(s): PepB, YfhI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 46.18
Isoelectric point: 5.703
Motif(s):
 
Type Positions Sequence
155 -> 155 Q
5 -> 81 MKITLSTQPADARWGEKATYSINNDGITLHLNGADDLGLIQRAARKIDGLGIKHVQLSGEGWDADRCWAFWQGYKAP
375 -> 427 STAAGFLSHFVENYQQGWLHIDCSATYRKAPVEQWSAGATGLGVRTIANLLTA
109 -> 421 WVRDTINAPAEELGPSQLAQRAVDLISNVAGDRVTYRITKGEDLREQGYMGLHTVGRGSERSPVLLALDYNPTGDKEAPVYACLVGKGITFDSGGYSIKQTAFMDSMKSDMGGAATVTGALAFAITRGLNKRVKLFLCCADNLISGNAFKLGDIITYRNGKKVEVMNTDAEGRLVLADGLIDASAQKPEMIIDAATLTGAAKTALGNDYHALFSFDDALAGRLLASAAQENEPFWRLPLAEFHRSQLPSNFAELNNTGSAAYPAGASTAAGFLSHFVENYQQGWLHIDCSATYRKAPVEQWSAGATGLGVRTI
41 -> 41 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004177 - aminopeptidase activity
GO:0008235 - metalloexopeptidase activity
GO:0030145 - manganese ion binding
GO:0042802 - identical protein binding
GO:0044212 - transcription regulatory region DNA binding
biological_process GO:0006508 - proteolysis
GO:0019538 - protein metabolic process
GO:0043171 - peptide catabolic process
External database links:  
DIP:
DIP-10455N
ECOCYC:
EG12310-MONOMER
ECOLIWIKI:
b2523
INTERPRO:
IPR000819
INTERPRO:
IPR011356
INTERPRO:
IPR008330
INTERPRO:
IPR001346
MINT:
MINT-1236207
MODBASE:
P37095
PANTHER:
PTHR11963
PANTHER:
PTHR11963:SF20
PDB:
6OV8
PDB:
6OAD
PFAM:
PF12404
PFAM:
PF00883
PRIDE:
P37095
PRINTS:
PR00481
PRODB:
PRO_000023508
PROSITE:
PS00631
REFSEQ:
NP_417018
SMR:
P37095
UNIPROT:
P37095


Operon      
Name: pepB         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Regulation by small RNA    
  Display Regulation
small RNA ryhB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2823 2656567 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2824 2656727 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB