RegulonDB RegulonDB 10.8: Gene Form
   

zapD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

zapD coaE yacG b0100 yacM TSS_229 TSS_229 TSS_228 TSS_228 TSS_227 TSS_227 TSS_226 TSS_226 TSS_225 TSS_225 TSS_224 TSS_224 TSS_223 TSS_223 TSS_222 TSS_222

Gene      
Name: zapD    Texpresso search in the literature
Synonym(s): ECK0102, EG12313, b0102, yacF
Genome position(nucleotides): 111856 <-- 112599 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.48
External database links:  
ASAP:
ABE-0000355
ECHOBASE:
EB2219
OU-MICROARRAY:
b0102
PortEco:
yacF
STRING:
511145.b0102
COLOMBOS: zapD


Product      
Name: cell division factor ZapD
Synonym(s): YacF, ZapD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.292
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
19 -> 225 LRIEFLIQQLTVNLPIVDHAGALHFFRNVSELLDVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLISAPRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDSQVETWIASLNPLTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRFAIR
215 -> 215 I

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032153 - cell division site
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0043093 - FtsZ-dependent cytokinesis
GO:0000917 - division septum assembly
GO:0090529 - cell septum assembly
External database links:  
ECOCYC:
EG12313-MONOMER
ECOLIWIKI:
b0102
INTERPRO:
IPR036268
INTERPRO:
IPR027462
INTERPRO:
IPR009777
PANTHER:
PTHR39455
PDB:
5IMJ
PDB:
5DKO
PDB:
5KOA
PFAM:
PF07072
PRIDE:
P36680
REFSEQ:
NP_414644
SMR:
P36680
UNIPROT:
P36680


Operon      
Name: coaE-zapD-yacG         
Operon arrangement:
Transcription unit        Promoter
yacG
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_222 112251 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_223 112273 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_224 112599 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_225 112607 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_226 112609 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_227 112617 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_228 112696 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_229 112703 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB