RegulonDB RegulonDB 10.8: Gene Form
   

yacG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

zapD mutT yacG b0100 TSS_224 TSS_224 TSS_223 TSS_223 TSS_222 TSS_222

Gene      
Name: yacG    Texpresso search in the literature
Synonym(s): ECK0101, EG12314, b0101
Genome position(nucleotides): 111649 <-- 111846 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.52
External database links:  
ASAP:
ABE-0000351
ECHOBASE:
EB2220
OU-MICROARRAY:
b0101
PortEco:
yacG
STRING:
511145.b0101
COLOMBOS: yacG


Product      
Name: DNA gyrase inhibitor YacG
Synonym(s): YacG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.306
Isoelectric point: 4.215
Motif(s):
 
Type Positions Sequence
7 -> 55 VNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSE

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0008657 - DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) inhibitor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:2000372 - negative regulation of DNA topoisomerase (ATP-hydrolyzing) activity
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Sengupta S., et al., 2008
External database links:  
DIP:
DIP-48126N
ECOCYC:
EG12314-MONOMER
ECOLIWIKI:
b0101
INTERPRO:
IPR005584
INTERPRO:
IPR013088
MINT:
MINT-1228215
MODBASE:
P0A8H8
PANTHER:
PTHR36150
PDB:
1LV3
PDB:
4TMA
PFAM:
PF03884
PRIDE:
P0A8H8
REFSEQ:
NP_414643
SMR:
P0A8H8
UNIPROT:
P0A8H8


Operon      
Name: coaE-zapD-yacG         
Operon arrangement:
Transcription unit        Promoter
yacG
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_222 112251 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_223 112273 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_224 112599 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sengupta S., Nagaraja V., 2008, YacG from Escherichia coli is a specific endogenous inhibitor of DNA gyrase., Nucleic Acids Res 36(13):4310-6

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB