RegulonDB RegulonDB 10.7: Gene Form
   

acnB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

acnB yacH yacL Fis CRP ArcA ArcA Fis ArcA ArcA ArcA ArcA ArcA Fis terminator anti-terminator anti-anti-terminator terminator anti-terminator anti-anti-terminator yacLp yacLp TSS_259 TSS_259 TSS_258 TSS_258 TSS_257 TSS_257 TSS_256 TSS_256 TSS_255 TSS_255 acnBp2 acnBp2 acnBp acnBp yacHp5 yacHp5 yacHp3 yacHp3 TSS_254 TSS_254

Gene      
Name: acnB    Texpresso search in the literature
Synonym(s): ECK0117, EG12316, b0118, yacI, yacJ
Genome position(nucleotides): 131615 --> 134212 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.89
External database links:  
ASAP:
ABE-0000411
CGSC:
36955
ECHOBASE:
EB2222
OU-MICROARRAY:
b0118
PORTECO:
acnB
REGULONDB:
b0118
STRING:
511145.b0118
M3D: acnB
COLOMBOS: acnB
PortEco: b0118


Product      
Name: AcnB
Synonym(s): YacI, YacJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 93.498
Isoelectric point: 5.041
Motif(s):
 
Type Positions Sequence
769 -> 769 C
4 -> 156 EYRKHVAERAAEGIAPKPLDANQMAALVELLKNPPAGEEEFLLDLLTNRVPPGVDEAAYVKAGFLAAIAKGEAKSPLLTPEKAIELLGTMQGGYNIHPLIDALDDAKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWF
168 -> 382 VTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNAREGIEPDQPGVVGPIKQIEALQQKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPHVPNKRGGGLCLGGKIAPIFFNTMEDAGALPIEVDVSNLNMGDVIDVYPYKGEVRNHETGELLATFELKTDVLIDEVRAGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESDRGF
244 -> 246 SSR
414 -> 416 QDT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0047780 - citrate dehydratase activity
GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0003723 - RNA binding
GO:0003729 - mRNA binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0003994 - aconitate hydratase activity
GO:0047456 - 2-methylisocitrate dehydratase activity
GO:0003730 - mRNA 3'-UTR binding
biological_process GO:0006097 - glyoxylate cycle
GO:0006099 - tricarboxylic acid cycle
GO:0006417 - regulation of translation
GO:0019629 - propionate catabolic process, 2-methylcitrate cycle
Note(s): Note(s): ...[more].
Reference(s): [1] Calderon IL., et al., 2009
[2] Kim CW., et al., 2007
[3] Maciag M., et al., 2012
[4] Stefanopoulou M., et al., 2011
External database links:  
DIP:
DIP-9044N
ECOCYC:
ACONITATEDEHYDRB-MONOMER
ECOLIWIKI:
b0118
INTERPRO:
IPR015928
INTERPRO:
IPR036008
INTERPRO:
IPR001030
INTERPRO:
IPR004406
INTERPRO:
IPR036288
INTERPRO:
IPR015929
INTERPRO:
IPR015931
INTERPRO:
IPR015932
INTERPRO:
IPR015933
INTERPRO:
IPR018136
MODBASE:
P36683
PANTHER:
PTHR43160:SF1
PDB:
1L5J
PFAM:
PF06434
PFAM:
PF11791
PFAM:
PF00330
PRIDE:
P36683
PRODB:
PRO_000022043
PROSITE:
PS00450
PROSITE:
PS01244
PROTEINMODELPORTAL:
P36683
REFSEQ:
NP_414660
SMR:
P36683
UNIPROT:
P36683


Operon      
Name: acnB         
Operon arrangement:
Transcription unit        Promoter
acnB
 


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Cra, ArcA, Fis


RNA cis-regulatory element    
Attenuation: Transcriptional


Regulation by small RNA    
  Display Regulation
small RNA ryhB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_254 130229 forward nd [RS-EPT-CBR] [5]
  promoter yacHp3 131307 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter yacHp5 131466 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter TSS_255 131743 forward nd [RS-EPT-CBR] [5]
  promoter TSS_256 132124 forward nd [RS-EPT-CBR] [5]
  promoter TSS_257 132840 forward nd [RS-EPT-CBR] [5]
  promoter TSS_258 133449 forward nd [RS-EPT-CBR] [5]
  promoter TSS_259 133468 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Calderon IL., Elias AO., Fuentes EL., Pradenas GA., Castro ME., Arenas FA., Perez JM., Vasquez CC., 2009, Tellurite-mediated disabling of [4Fe-4S] clusters of Escherichia coli dehydratases., Microbiology 155(Pt 6):1840-6

 [2] Kim CW., Han KS., Ryu KS., Kim BH., Kim KH., Choi SI., Seong BL., 2007, N-terminal domains of native multidomain proteins have the potential to assist de novo folding of their downstream domains in vivo by acting as solubility enhancers., Protein Sci 16(4):635-43

 [3] Maciag M., Nowicki D., Szalewska-Palasz A., Wegrzyn G., 2012, Central carbon metabolism influences fidelity of DNA replication in Escherichia coli., Mutat Res 731(1-2):99-106

 [4] Stefanopoulou M., Kokoschka M., Sheldrick WS., Wolters DA., 2011, Cell response of Escherichia coli to cisplatin-induced stress., Proteomics 11(21):4174-88

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB