RegulonDB RegulonDB 10.7: Gene Form
   

yadG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yadG yadH can yadI anti-terminator yadEp3 yadEp3 canp canp

Gene      
Name: yadG    Texpresso search in the literature
Synonym(s): ECK0126, EG12320, b0127
Genome position(nucleotides): 142779 --> 143705 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.62
External database links:  
ASAP:
ABE-0000447
ECHOBASE:
EB2225
MIM:
610921
OU-MICROARRAY:
b0127
PORTECO:
yadG
REGULONDB:
b0127
STRING:
511145.b0127
M3D: yadG
COLOMBOS: yadG
PortEco: b0127


Product      
Name: putative ABC transporter ATP-binding protein YadG
Synonym(s): YadG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 34.647
Isoelectric point: 8.814
Motif(s):
 
Type Positions Sequence
38 -> 45 GPNGAGKS
5 -> 236 LELQQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGKSTTIGIISSLVNKTSGRVSVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAGYYGVERKEAYIRSEKYLKQLDLWGKRNERARMLSGGMKRRLMIARALMHEPKLLILDEPTAGVDIELRRSMWGFLKDLNDKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKALLAKLKSETFILDL
21 -> 165 LRGIDLQVEAGDFYALLGPNGAGKSTTIGIISSLVNKTSGRVSVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAGYYGVERKEAYIRSEKYLKQLDLWGKRNERARMLSGGMKRRLMIARALMHEPKLLILDEPTA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0010165 - response to X-ray
GO:0006810 - transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-11185N
ECOCYC:
YADG-MONOMER
ECOLIWIKI:
b0127
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR017871
INTERPRO:
IPR027417
MINT:
MINT-1289416
MODBASE:
P36879
PFAM:
PF00005
PRIDE:
P36879
PROSITE:
PS50893
PROSITE:
PS00211
PROTEINMODELPORTAL:
P36879
REFSEQ:
NP_414669
SMART:
SM00382
SMR:
P36879
UNIPROT:
P36879


Operon      
Name: yadGH         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yadEp3 144965 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB