RegulonDB RegulonDB 10.8: Gene Form
   

yadG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yadG    Texpresso search in the literature
Synonym(s): ECK0126, EG12320, b0127
Genome position(nucleotides): 142779 --> 143705 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.62
External database links:  
ASAP:
ABE-0000447
ECHOBASE:
EB2225
MIM:
610921
OU-MICROARRAY:
b0127
PortEco:
yadG
STRING:
511145.b0127
COLOMBOS: yadG


Product      
Name: putative ABC transporter ATP-binding protein YadG
Synonym(s): YadG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 34.647
Isoelectric point: 8.814
Motif(s):
 
Type Positions Sequence
38 -> 45 GPNGAGKS
5 -> 236 LELQQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGKSTTIGIISSLVNKTSGRVSVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAGYYGVERKEAYIRSEKYLKQLDLWGKRNERARMLSGGMKRRLMIARALMHEPKLLILDEPTAGVDIELRRSMWGFLKDLNDKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKALLAKLKSETFILDL
21 -> 165 LRGIDLQVEAGDFYALLGPNGAGKSTTIGIISSLVNKTSGRVSVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAGYYGVERKEAYIRSEKYLKQLDLWGKRNERARMLSGGMKRRLMIARALMHEPKLLILDEPTA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0010165 - response to X-ray
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-11185N
ECOCYC:
YADG-MONOMER
ECOLIWIKI:
b0127
INTERPRO:
IPR003439
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003593
MINT:
MINT-1289416
MODBASE:
P36879
PFAM:
PF00005
PRIDE:
P36879
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_414669
SMART:
SM00382
SMR:
P36879
UNIPROT:
P36879


Operon      
Name: yadGH         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yadEp3 144965 forward Similarity to the consensus
Read more >
[ICWHO] [2]



RegulonDB