RegulonDB RegulonDB 10.7: Gene Form
   

yadH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yadG yadH can yadI anti-terminator yadEp3 yadEp3 canp canp

Gene      
Name: yadH    Texpresso search in the literature
Synonym(s): ECK0127, EG12321, b0128
Genome position(nucleotides): 143702 --> 144472 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.71
External database links:  
ASAP:
ABE-0000450
ECHOBASE:
EB2226
OU-MICROARRAY:
b0128
PORTECO:
yadH
REGULONDB:
b0128
STRING:
511145.b0128
M3D: yadH
COLOMBOS: yadH
PortEco: b0128


Product      
Name: putative ABC transporter membrane subunit YadH
Synonym(s): YadH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 28.516
Isoelectric point: 9.867
Motif(s):
 
Type Positions Sequence
9 -> 218 LKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNLIGSRIGDMHGFSYMQFIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHVIIAGYVGGGVARGLFVGILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVFAKTFDDISLVPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGF
53 -> 73 MHGFSYMQFIVPGLIMMSVIT
139 -> 159 WVFVALTLVLTAVLFSLAGLL
214 -> 214 F
22 -> 251 RIWVQTLVPPVITMTLYFIIFGNLIGSRIGDMHGFSYMQFIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHVIIAGYVGGGVARGLFVGILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVFAKTFDDISLVPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGINDVPLVTTFGVLVVFIVAFYLICWSLIQRG

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
biological_process GO:0006810 - transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Babu M., et al., 2018
External database links:  
ECOCYC:
YADH-MONOMER
ECOLIWIKI:
b0128
INTERPRO:
IPR000412
INTERPRO:
IPR013525
PANTHER:
PTHR30413
PFAM:
PF01061
PRIDE:
P0AFN6
PRINTS:
PR00164
PROSITE:
PS51012
PROTEINMODELPORTAL:
P0AFN6
REFSEQ:
NP_414670
UNIPROT:
P0AFN6


Operon      
Name: yadGH         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yadEp3 144965 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Babu M., Bundalovic-Torma C., Calmettes C., Phanse S., Zhang Q., Jiang Y., Minic Z., Kim S., Mehla J., Gagarinova A., Rodionova I., Kumar A., Guo H., Kagan O., Pogoutse O., Aoki H., Deineko V., Caufield JH., Holtzapple E., Zhang Z., Vastermark A., Pandya Y., Lai CC., El Bakkouri M., Hooda Y., Shah M., Burnside D., Hooshyar M., Vlasblom J., Rajagopala SV., Golshani A., Wuchty S., F Greenblatt J., Saier M., Uetz P., F Moraes T., Parkinson J., Emili A., 2018, Global landscape of cell envelope protein complexes in Escherichia coli., Nat Biotechnol 36(1):103-112

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB