RegulonDB RegulonDB 10.7: Gene Form
   

yadI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yadE yadH yadI yadG terminator anti-terminator yadEp4 yadEp4 yadEp3 yadEp3

Gene      
Name: yadI    Texpresso search in the literature
Synonym(s): ECK0128, EG12322, agaX, b0129
Genome position(nucleotides): 144577 --> 145017 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.21
External database links:  
ASAP:
ABE-0000453
ECHOBASE:
EB2227
OU-MICROARRAY:
b0129
PORTECO:
yadI
REGULONDB:
b0129
STRING:
511145.b0129
M3D: yadI
COLOMBOS: yadI
PortEco: b0129


Product      
Name: putative PTS enzyme IIA component YadI
Synonym(s): AgaX, YadI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 16.54
Isoelectric point: 6.389
Motif(s):
 
Type Positions Sequence
1 -> 124 MLGWVITCHDDRAQEILDALEKKHGALLQCRAVNFWRGLSSNMLSRMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACRETMTSSEFRERIVELGAPEV
3 -> 116 GWVITCHDDRAQEILDALEKKHGALLQCRAVNFWRGLSSNMLSRMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACRETMTSSEFRERI

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
AGAX-MONOMER
ECOLIWIKI:
b0129
INTERPRO:
IPR033887
INTERPRO:
IPR004701
INTERPRO:
IPR036662
MODBASE:
P36881
PFAM:
PF03610
PRIDE:
P36881
PROSITE:
PS51096
PROTEINMODELPORTAL:
P36881
REFSEQ:
NP_414671
SMR:
P36881
UNIPROT:
P36881


Operon      
Name: yadI         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yadEp3 144965 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yadEp4 145053 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB