RegulonDB RegulonDB 10.8: Gene Form
   

yadK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yadC yadL yadK

Gene      
Name: yadK    Texpresso search in the literature
Synonym(s): ECK0135, EG12325, b0136
Genome position(nucleotides): 151003 <-- 151599 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.37
External database links:  
ASAP:
ABE-0000472
ECHOBASE:
EB2229
OU-MICROARRAY:
b0136
PortEco:
yadK
STRING:
511145.b0136
COLOMBOS: yadK


Product      
Name: putative fimbrial protein YadK
Synonym(s): YadK
Sequence: Get amino acid sequence Fasta Format
Cellular location: pilus
Molecular weight: 21.112
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
36 -> 197 ANVKNSTCKSGISNQGNIDLGVVGVGYFSGNVTPESYQPGGKEFTITVSDCALQGTGDVLNQLHIDFRALSGVMAAGSRQIFANEISSGASNVGVVIFSTQDSANTFNVLNASGGSRSVYPVMSDDMNGSSWKFSTRMQKIDPALSVTSGQLMSHVLVDIYY
1 -> 28 MHPTQRKLMKRIILFLSLLFCIACPAIA
29 -> 198 GQDIDLVANVKNSTCKSGISNQGNIDLGVVGVGYFSGNVTPESYQPGGKEFTITVSDCALQGTGDVLNQLHIDFRALSGVMAAGSRQIFANEISSGASNVGVVIFSTQDSANTFNVLNASGGSRSVYPVMSDDMNGSSWKFSTRMQKIDPALSVTSGQLMSHVLVDIYYE

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Larsonneur F., et al., 2016
[4] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
EG12325-MONOMER
ECOLIWIKI:
b0136
INTERPRO:
IPR008966
INTERPRO:
IPR036937
INTERPRO:
IPR000259
MODBASE:
P37016
PFAM:
PF00419
PRIDE:
P37016
REFSEQ:
NP_414678
SMR:
P37016
UNIPROT:
P37016


Operon      
Name: yadMLKC         
Operon arrangement:
Transcription unit        Promoter
yadC
yadMLKC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Larsonneur F., Martin FA., Mallet A., Martinez-Gil M., Semetey V., Ghigo JM., Beloin C., 2016, Functional analysis of Escherichia coli Yad fimbriae reveals their potential role in environmental persistence., Environ Microbiol 18(12):5228-5248

 [4] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835


RegulonDB