RegulonDB RegulonDB 10.8: Gene Form
   

cdaR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

degP cdaR yaeH TSS_307 TSS_307 cdaRp cdaRp

Gene      
Name: cdaR    Texpresso search in the literature
Synonym(s): ECK0161, EG12335, b0162, sdaR, yaeG
Genome position(nucleotides): 182463 --> 183620 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.85
External database links:  
ASAP:
ABE-0000554
ECHOBASE:
EB2239
OU-MICROARRAY:
b0162
PortEco:
cdaR
STRING:
511145.b0162
COLOMBOS: cdaR


Product      
Name: DNA-binding transcriptional activator CdaR
Synonym(s): CdaR, SdaR, YaeG
Sequence: Get amino acid sequence Fasta Format
Regulator Family: Cdar
Molecular weight: 43.687
Isoelectric point: 6.737
Motif(s):
 
Type Positions Sequence
6 -> 138 LDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIGELHEGALLVLSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPENLRKYGELVCMTAEMMLEQSRLMHLLAQDSRLREELVMN
145 -> 271 NTPALTEWAQRLGIDLNQPRVVAIVEVDSGQLGVDSAMAELQQLQNALTTPERNNLVAIVSLTEMVVLKPALNSFGRWDAEDHRKRVEQLITRMKEYGQLRFRVSLGNYFTGPGSIARSYRTAKTTM
323 -> 380 LRRTLAAWFRHNVQPLATSKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQ
292 -> 292 P

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
Gene Ontology Terms (GO)  
molecular_function GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0045893 - positive regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [GEA] Gene expression analysis
[IFC] Inferred by functional complementation
Reference(s): [1] Monterrubio R., et al., 2000
[2] Sampaio MM., et al., 2004
External database links:  
DIP:
DIP-9258N
ECOCYC:
EG12335-MONOMER
ECOLIWIKI:
b0162
INTERPRO:
IPR041522
INTERPRO:
IPR025736
INTERPRO:
IPR008599
INTERPRO:
IPR042070
PFAM:
PF05651
PFAM:
PF13556
PFAM:
PF17853
PRIDE:
P37047
PRODB:
PRO_000022264
REFSEQ:
NP_414704
SMR:
P37047
UNIPROT:
P37047


Operon      
Name: cdaR         
Operon arrangement:
Transcription unit        Promoter
cdaR


Transcriptional Regulation      
Display Regulation             
Activated by: CdaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_307 183840 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Monterrubio R., Baldoma L., Obradors N., Aguilar J., Badia J., 2000, A common regulator for the operons encoding the enzymes involved in D-galactarate, D-glucarate, and D-glycerate utilization in Escherichia coli., J Bacteriol 182(9):2672-4

 [2] Sampaio MM., Chevance F., Dippel R., Eppler T., Schlegel A., Boos W., Lu YJ., Rock CO., 2004, Phosphotransferase-mediated transport of the osmolyte 2-O-alpha-mannosyl-D-glycerate in Escherichia coli occurs by the product of the mngA (hrsA) gene and is regulated by the mngR (farR) gene product acting as repressor., J Biol Chem 279(7):5537-48

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB