RegulonDB RegulonDB 10.8: Gene Form
   

yagB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yagA yagB insAB2 insA2 insX insI2 insB2 TSS_469 TSS_469 TSS_468 TSS_468 TSS_467 (cluster) TSS_467 (cluster)

Gene      
Name: yagB    Texpresso search in the literature
Synonym(s): ECK0267, EG12339, b0266
Genome position(nucleotides): 280385 <-- 280735 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.0
External database links:  
ASAP:
ABE-0000912
ECHOBASE:
EB2243
ECOO157CYC:
Z1658
ECOO157CYC:
Z1220
OU-MICROARRAY:
b0266
PortEco:
yagB
STRING:
316407.85674410
COLOMBOS: yagB


Product      
Name: CP4-6 prophage; orphan antitoxin YagB
Synonym(s): CP4-6 prophage; putative cytoskeleton-binding protein YagB, YagB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.184
Isoelectric point: 7.673
Motif(s):
 
Type Positions Sequence
7 -> 105 QTWGLKRDITPCFGARLVQEGHRLHFLADRAGFTGSFSEVQTLQLDEAFPHFVAHLELMLLSCELNPRYAHCVTLYRNGLTGEADTLGSHGYVYIAILN

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0051495 - positive regulation of cytoskeleton organization
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12339-MONOMER
ECOLIWIKI:
b0266
ECOO157CYC:
Z1220-MONOMER
ECOO157CYC:
Z1658-MONOMER
INTERPRO:
IPR009320
INTERPRO:
IPR038025
PFAM:
PF06154
PRIDE:
P37008
REFSEQ:
NP_414800
SMR:
P37008
UNIPROT:
P37008


Operon      
Name: yagAB-insX         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_467 (cluster) 279709 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_468 279891 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_469 279893 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB