RegulonDB RegulonDB 10.8: Gene Form
   

rseA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rseB rseA rpoE rseC rseD DksA DksA-ppGpp DksA-ppGpp ppGpp anti-terminator terminator terminator TSS_2871 TSS_2871 TSS_2870 TSS_2870 rseAp3 rseAp3 TSS_2869 TSS_2869

Gene      
Name: rseA    Texpresso search in the literature
Synonym(s): ECK2570, EG12341, b2572, mclA, yfiJ
Genome position(nucleotides): 2708754 <-- 2709404 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.23
External database links:  
ASAP:
ABE-0008462
CGSC:
37241
ECHOBASE:
EB2245
OU-MICROARRAY:
b2572
PortEco:
rseA
STRING:
511145.b2572
COLOMBOS: rseA


Product      
Name: anti-sigma-E factor RseA
Synonym(s): MclA, RseA, YfiJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.321
Isoelectric point: 4.889
Motif(s):
 
Type Positions Sequence
85 -> 85 W
132 -> 186 ETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDYELQRRL
185 -> 185 R
147 -> 147 P
101 -> 118 LTQMGVAACVSLAVIVGV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.1 - sigma factors, anti-sigmafactors
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016989 - sigma factor antagonist activity
biological_process GO:0006950 - response to stress
GO:1903507 - negative regulation of nucleic acid-templated transcription
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IMP] Inferred from mutant phenotype
[IPI] Inferred from physical interaction
Reference(s): [1] Ades SE., et al., 2003
[2] Alba BM., et al., 2001
[3] De Las Penas A., et al., 1997
[4] McBroom AJ., et al., 2006
[5] Missiakas D., et al., 1997
External database links:  
DIP:
DIP-39581N
DISPROT:
DP00552
ECOCYC:
EG12341-MONOMER
ECOLIWIKI:
b2572
INTERPRO:
IPR026279
INTERPRO:
IPR036147
INTERPRO:
IPR005573
INTERPRO:
IPR005572
MODBASE:
P0AFX7
PDB:
3M4W
PDB:
1OR7
PDB:
1YFN
PFAM:
PF03872
PFAM:
PF03873
PRIDE:
P0AFX7
PRODB:
PRO_000023877
REFSEQ:
NP_417067
SMR:
P0AFX7
SWISSMODEL:
P0AFX7
UNIPROT:
P0AFX7


Operon      
Name: rseD-rpoE-rseABC         
Operon arrangement:
Transcription unit        Promoter
rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, NtrC, GlrR, RcsB
Repressed by: CpxR, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2869 2709043 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_2870 2709761 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_2871 2709854 reverse nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ades SE., Grigorova IL., Gross CA., 2003, Regulation of the alternative sigma factor sigma(E) during initiation, adaptation, and shutoff of the extracytoplasmic heat shock response in Escherichia coli., J Bacteriol 185(8):2512-9

 [2] Alba BM., Zhong HJ., Pelayo JC., Gross CA., 2001, degS (hhoB) is an essential Escherichia coli gene whose indispensable function is to provide sigma (E) activity., Mol Microbiol 40(6):1323-33

 [3] De Las Penas A., Connolly L., Gross CA., 1997, The sigmaE-mediated response to extracytoplasmic stress in Escherichia coli is transduced by RseA and RseB, two negative regulators of sigmaE., Mol Microbiol 24(2):373-85

 [4] McBroom AJ., Johnson AP., Vemulapalli S., Kuehn MJ., 2006, Outer membrane vesicle production by Escherichia coli is independent of membrane instability., J Bacteriol 188(15):5385-92

 [5] Missiakas D., Mayer MP., Lemaire M., Georgopoulos C., Raina S., 1997, Modulation of the Escherichia coli sigmaE (RpoE) heat-shock transcription-factor activity by the RseA, RseB and RseC proteins., Mol Microbiol 24(2):355-71

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB