RegulonDB RegulonDB 10.7: Gene Form
   

ydfG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dcp ydfG ydfH PhoB ydfHp ydfHp ydfGp ydfGp TSS_1848 TSS_1848 dcpp3 dcpp3 TSS_1847 TSS_1847 TSS_1846 TSS_1846

Gene      
Name: ydfG    Texpresso search in the literature
Synonym(s): ECK1532, EG12345, b1539
Genome position(nucleotides): 1627517 --> 1628263 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.6
External database links:  
ASAP:
ABE-0005137
ECHOBASE:
EB2249
OU-MICROARRAY:
b1539
PORTECO:
ydfG
REGULONDB:
b1539
STRING:
511145.b1539
M3D: ydfG
COLOMBOS: ydfG
PortEco: b1539


Product      
Name: 3-hydroxy acid dehydrogenase
Synonym(s): YdfG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.249
Isoelectric point: 5.893
Motif(s):
 
Type Positions Sequence
2 -> 187 IVLVTGATAGFGECITRRFIQQGHKVIATGRRQERLQELKDELGDNLYIAQLDVRNRAAIEEMLASLPAEWCNIDILVNNAGLALGMEPAHKASVEDWETMIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTAGSWPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLVGGTEFSN
182 -> 182 G
32 -> 33 RR
177 -> 185 PGLVGGTEF
7 -> 12 GATAGF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0008442 - 3-hydroxyisobutyrate dehydrogenase activity
GO:0016491 - oxidoreductase activity
GO:0031132 - serine 3-dehydrogenase activity
GO:0042802 - identical protein binding
GO:0035527 - 3-hydroxypropionate dehydrogenase (NADP+) activity
biological_process GO:0055114 - oxidation-reduction process
GO:0006212 - uracil catabolic process
GO:0051289 - protein homotetramerization
Note(s): Note(s): ...[more].
Reference(s): [1] Song CW., et al., 2016
External database links:  
DIP:
DIP-11696N
ECOCYC:
EG12345-MONOMER
ECOLIWIKI:
b1539
INTERPRO:
IPR036291
INTERPRO:
IPR020904
INTERPRO:
IPR002347
MODBASE:
P39831
PANTHER:
PTHR24322
PFAM:
PF00106
PRIDE:
P39831
PRINTS:
PR00080
PRINTS:
PR00081
PROSITE:
PS00061
PROTEINMODELPORTAL:
P39831
REFSEQ:
NP_416057
SMR:
P39831
SWISSMODEL:
P39831
UNIPROT:
P39831


Operon      
Name: ydfG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1846 1625884 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1847 1626295 reverse nd [RS-EPT-CBR] [2]
  promoter dcpp3 1627422 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_1848 1627489 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Song CW., Kim JW., Cho IJ., Lee SY., 2016, Metabolic Engineering of Escherichia coli for the Production of 3-Hydroxypropionic Acid and Malonic Acid through β-Alanine Route., ACS Synth Biol 5(11):1256-1263

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB