RegulonDB RegulonDB 10.7: Gene Form
   

tcyN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dcyD tcyN tcyL sdsN yecCp3 yecCp3

Gene      
Name: tcyN    Texpresso search in the literature
Synonym(s): ECK1916, EG12347, b1917, yecC
Genome position(nucleotides): 1997062 <-- 1997814 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.32
External database links:  
ASAP:
ABE-0006384
ECHOBASE:
EB2251
OU-MICROARRAY:
b1917
PORTECO:
yecC
REGULONDB:
b1917
STRING:
511145.b1917
M3D: tcyN
COLOMBOS: tcyN
PortEco: b1917


Product      
Name: cystine ABC transporter ATP binding subunit
Synonym(s): TcyN, YecC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 27.677
Isoelectric point: 9.619
Motif(s):
 
Type Positions Sequence
4 -> 244 IEVKNLVKKFHGQTVLHGIDLEVKPGEVVAIIGPSGSGKTTLLRSINLLEQPEAGTITVGDITIDTARSLSQQKSLIRQLRQHVGFVFQNFNLFPHRTVLENIIEGPVIVKGEPKEEATARARELLAKVGLAGKETSYPRRLSGGQQQRVAIARALAMRPEVILFDEPTSALDPELVGEVLNTIRQLAQEKRTMVIVTHEMSFARDVADRAIFMDQGRIVEQGAAKALFADPEQPRTRQFL
36 -> 43 GPSGSGKT
19 -> 173 LHGIDLEVKPGEVVAIIGPSGSGKTTLLRSINLLEQPEAGTITVGDITIDTARSLSQQKSLIRQLRQHVGFVFQNFNLFPHRTVLENIIEGPVIVKGEPKEEATARARELLAKVGLAGKETSYPRRLSGGQQQRVAIARALAMRPEVILFDEPTS
148 -> 148 G
165 -> 172 VILFDEPT

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016787 - hydrolase activity
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015424 - ATPase-coupled amino acid transmembrane transporter activity
GO:0015426 - ATPase-coupled polar amino acid-transporter activity
GO:0015184 - L-cystine transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0003333 - amino acid transmembrane transport
GO:0015811 - L-cystine transport
GO:0015830 - diaminopimelate transport
Note(s): Note(s): ...[more].
Reference(s): [1] Ahmer BM., et al., 1998
[2] Michael B., et al., 2001
External database links:  
DIP:
DIP-11822N
ECOCYC:
EG12347-MONOMER
ECOLIWIKI:
b1917
INTERPRO:
IPR003593
INTERPRO:
IPR030679
INTERPRO:
IPR027417
INTERPRO:
IPR003439
INTERPRO:
IPR017871
MINT:
MINT-1262709
MODBASE:
P37774
PFAM:
PF00005
PRIDE:
P37774
PROSITE:
PS00211
PROSITE:
PS50893
PROTEINMODELPORTAL:
P37774
REFSEQ:
NP_416427
SMART:
SM00382
SMR:
P37774
SWISSMODEL:
P37774
UNIPROT:
P37774


Operon      
Name: dcyD-tcyLN         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yecCp3 1997823 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Ahmer BM., van Reeuwijk J., Timmers CD., Valentine PJ., Heffron F., 1998, Salmonella typhimurium encodes an SdiA homolog, a putative quorum sensor of the LuxR family, that regulates genes on the virulence plasmid., J Bacteriol 180(5):1185-93

 [2] Michael B., Smith JN., Swift S., Heffron F., Ahmer BM., 2001, SdiA of Salmonella enterica is a LuxR homolog that detects mixed microbial communities., J Bacteriol 183(19):5733-42

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB