RegulonDB RegulonDB 10.6.3: Gene Form
   

znuB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ruvB znuA znuB znuC Zur OxyR znuAp znuAp znuCp znuCp yebAp5 yebAp5 yebAp6 yebAp6 yebAp1 yebAp1

Gene      
Name: znuB    Texpresso search in the literature
Synonym(s): ECK1860, EG12368, b1859, yebI
Genome position(nucleotides): 1943414 --> 1944199 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.91
External database links:  
ASAP:
ABE-0006201
ECHOBASE:
EB2271
ECOCYC:
EG12368
ECOLIHUB:
znuB
OU-MICROARRAY:
b1859
REGULONDB:
b1859
STRING:
511145.b1859
M3D: znuB
COLOMBOS: znuB
PortEco: b1859


Product      
Name: Zn2+ ABC transporter membrane subunit
Synonym(s): YebI, ZnuB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 27.729
Isoelectric point: 8.712
Motif(s):
 
Type Positions Sequence
1 -> 257 MIELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAVIAVTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLMSNIRVDLMAYLFGDLLAVTPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGVKLQRVKLLLMLVTALTIGVAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGMVAVTGGLTFSAVYDTPAGPSVVLCAALLFILSMMK
84 -> 104 TLLGIMAHSALSLGLVVVSLM
178 -> 198 LTIGVAMKFVGALIITSLLII
54 -> 74 VNPFYAVIAVTLLLAGGLVWL
236 -> 256 DTPAGPSVVLCAALLFILSMM

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0000006 - high-affinity zinc transmembrane transporter activity
GO:0042626 - ATPase activity, coupled to transmembrane movement of substances
biological_process GO:0071578 - zinc ion import across plasma membrane
GO:0006811 - ion transport
GO:0006829 - zinc ion transport
GO:0055085 - transmembrane transport
GO:0010043 - response to zinc ion
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
ZNUB-MONOMER
ECOLIWIKI:
b1859
INTERPRO:
IPR001626
INTERPRO:
IPR037294
MODBASE:
P39832
PANTHER:
PTHR30477
PFAM:
PF00950
PRIDE:
P39832
PRODB:
PRO_000024253
PROTEINMODELPORTAL:
P39832
REFSEQ:
NP_416373
UNIPROT:
P39832


Operon      
Name: znuCB         
Operon arrangement:
Transcription unit        Promoter
znuCB


Transcriptional Regulation      
Display Regulation             
Activated by: OxyR
Repressed by: Zur
Growth Conditions:

[1] 

C: Escherichia coli| znuB knockout mutant| MacConkey agar| (NH4)2Fe(SO4)2 30 µM| 30.0 C
E: Escherichia coli| znuB knockout mutant| MacConkey agar| (NH4)2Fe(SO4)2 30 µM; zinc sulfate 1 mM| 30.0 C

[2] 

C: Escherichia coli| znuB knockout mutant| MacConkey agar| 30.0 C
E: Escherichia coli| znuB knockout mutant| MacConkey agar| MnCl2 1 mM| 30.0 C

[3] 

C: Escherichia coli| znuB knockout mutant| MacConkey agar| 30.0 C
E: Escherichia coli| znuB knockout mutant| MacConkey agar| (NH4)2Fe(SO4)2 10 mM| 30.0 C

[4] 

C: Escherichia coli| znuB knockout mutant| MacConkey agar| (NH4)2Fe(SO4)2 30 µM| 30.0 C
E: Escherichia coli| znuB knockout mutant| MacConkey agar| (NH4)2Fe(SO4)2 30 µM; desferrioxamine B mesylate 20 mM| 30.0 C

[5] 

C: Escherichia coli| znuB knockout mutant| MacConkey agar| 30.0 C
E: Escherichia coli| znuB knockout mutant| MacConkey agar| EGTA 50 mM| 30.0 C



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yebAp1 1941683 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yebAp6 1941721 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yebAp5 1941833 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB