RegulonDB RegulonDB 10.8: Gene Form
   

ppnN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ppnN sdaC queF sdaCp sdaCp TSS_3114 TSS_3114 TSS_3113 TSS_3113 TSS_3112 TSS_3112 sydp2 sydp2

Gene      
Name: ppnN    Texpresso search in the literature
Synonym(s): ECK2790, EG12373, b2795, ygdH
Genome position(nucleotides): 2926308 --> 2927672 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.36
External database links:  
ASAP:
ABE-0009166
ECHOBASE:
EB2276
OU-MICROARRAY:
b2795
PortEco:
ygdH
STRING:
511145.b2795
COLOMBOS: ppnN


Product      
Name: nucleotide 5'-monophosphate nucleosidase
Synonym(s): PpnN, YgdH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 50.972
Isoelectric point: 6.44
Motif(s):
 
Type Positions Sequence
190 -> 329 MEAPMKGAAVGHAQQRYKDSRFIGMTEPSIIAAEPPNPLVNELIIMPDIEKRLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMNPANKDQVLPLILTGPKESADYFRVLDEFVVHTLGENARRHYRIIIDDAAEVARQM
333 -> 452 MPLVKENRRDTGDAYSFNWSMRIAPDLQMPFEPSHENMANLKLYPDQPVEVLAADLRRAFSGIVAGNVKEVGIRAIEEFGPYKINGDKEIMRRMDDLLQGFVAQHRMKLPGSAYIPCYEI
389 -> 389 R
4 -> 109 HISPLGSMDMLSQLEVDMLKRTASSDLYQLFRNCSLAVLNSGSLTDNSKELLSRFENFDINVLRRERGVKLELINPPEEAFVDGRIIRALQANLFAVLRDILFVYG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.10 - sugar nucleotide biosynthesis, conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0047723 - inosinate nucleosidase activity
GO:0016787 - hydrolase activity
GO:0008714 - AMP nucleosidase activity
GO:0042802 - identical protein binding
GO:0097216 - guanosine tetraphosphate binding
GO:0047405 - pyrimidine-5'-nucleotide nucleosidase activity
biological_process GO:0051289 - protein homotetramerization
External database links:  
DIP:
DIP-47955N
ECOCYC:
EG12373-MONOMER
ECOLIWIKI:
b2795
INTERPRO:
IPR037153
INTERPRO:
IPR027820
INTERPRO:
IPR021826
INTERPRO:
IPR031100
MINT:
MINT-1293384
MODBASE:
P0ADR8
PDB:
6GFL
PDB:
6GFM
PFAM:
PF14793
PFAM:
PF11892
PFAM:
PF03641
PRIDE:
P0ADR8
REFSEQ:
NP_417275
SMR:
P0ADR8
UNIPROT:
P0ADR8


Operon      
Name: ppnN         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter sydp2 2925369 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3112 2926272 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3113 2926407 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3114 2926537 forward nd [RS-EPT-CBR] [2]
  promoter sdaCp 2928035 forward A σ32-dependent
Read more >
[AIPP] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [AIPP] Automated inference of promoter position



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB