RegulonDB RegulonDB 10.8: Gene Form
   

ycaI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycaI msbA ihfB lpxK terminator anti-terminator anti-anti-terminator TSS_1189 TSS_1189 ycaIp7 ycaIp7 ycaIp8 ycaIp8 ycaIp6 ycaIp6 TSS_1188 TSS_1188

Gene      
Name: ycaI    Texpresso search in the literature
Synonym(s): ECK0904, EG12375, b0913
Genome position(nucleotides): 964320 --> 966584 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.49
External database links:  
ASAP:
ABE-0003111
ECHOBASE:
EB2278
OU-MICROARRAY:
b0913
PortEco:
ycaI
STRING:
511145.b0913
COLOMBOS: ycaI


Product      
Name: metallo-β-lactamase superfamily inner membrane protein YcaI
Synonym(s): YcaI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 84.474
Isoelectric point: 8.536
Motif(s):
 
Type Positions Sequence
201 -> 467 GMGERLSVPKEIKNIMRDTGTAHLMAISGLHIAFAALLAAGLIRSGQIFLPGRWIHWQIPLIGGICCAAFYAWLTGMQPPALRTMVALATWGMLKLSGRQWSGWDVWICCLAAILLMDPVAILSQSLWLSAAAVAALIFWYQWFPCPEWQLPPVLRAVVSLIHLQLGITLLLMPVQIVIFHGISLTSFIANLLAIPLVTFITVPLILAAMVVHLSGPLILEQGLWFLADRSLALLFWGLKSLPEGWINIAECWQWLSFSPWFLLVVW
446 -> 466 WINIAECWQWLSFSPWFLLVV
505 -> 684 DVGQGLAMVIARNGKAILYDTGLAWPEGDSGQQLIIPWLHWHNLEPEGVILSHEHLDHRGGLDSILHIWPMLWIRSPLNWEHHQPCVRGEAWQWQGLRFSAHWPLQGSNDKGNNHSCVVKVDDGTNSILLTGDIEAPAEQKMLSRYWQQVQATLLQVPHHGSNTSSSLPLIQRVNGKVAL
24 -> 44 PGTLTLAFLTLFACVLAFIPV
370 -> 390 LLLMPVQIVIFHGISLTSFIA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0030420 - establishment of competence for transformation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12375-MONOMER
ECOLIWIKI:
b0913
INTERPRO:
IPR004797
INTERPRO:
IPR036866
INTERPRO:
IPR035681
INTERPRO:
IPR004477
INTERPRO:
IPR001279
MODBASE:
P37443
PFAM:
PF03772
PFAM:
PF00753
PRIDE:
P37443
REFSEQ:
NP_415433
SMART:
SM00849
SMR:
P37443
UNIPROT:
P37443


Operon      
Name: ycaI-msbA-lpxK-ycaQ         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1188 964101 forward nd [RS-EPT-CBR] [1]
  promoter ycaIp6 964105 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ycaIp8 964108 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ycaIp7 964238 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1189 966594 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB