RegulonDB RegulonDB 10.8: Gene Form
   

yecE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aspS yecE yecD yecN terminator anti-terminator anti-anti-terminator TSS_2220 TSS_2220 yecDp4 yecDp4 yecDp7 yecDp7 aspSp1 aspSp1 yecDp8 yecDp8 aspSp aspSp TSS_2218 TSS_2218 TSS_2217 TSS_2217 TSS_2216 (cluster) TSS_2216 (cluster) TSS_2215 TSS_2215 TSS_2214 TSS_2214

Gene      
Name: yecE    Texpresso search in the literature
Synonym(s): ECK1869, EG12379, b1868
Genome position(nucleotides): 1951395 --> 1952213 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.04
External database links:  
ASAP:
ABE-0006233
ECHOBASE:
EB2281
OU-MICROARRAY:
b1868
PortEco:
yecE
STRING:
511145.b1868
COLOMBOS: yecE


Product      
Name: DUF72 domain-containing protein YecE
Synonym(s): YecE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.479
Isoelectric point: 8.156
Motif(s):
 
Type Positions Sequence
21 -> 248 SLEEYARHFNCVEGNTTLYALPKPEVVLRWREQTTDDFRFCFKFPATISHQAALRHCDDLVTEFLTRMSPLAPRIGQYWLQLPATFGPRELPALWHFLDSLPGEFNYGVEVRHPQFFAKGEEEQTLNRGLHQRGVNRVILDSRPVHAARPHSEAIRDAQRKKPKVPVHAVLTATNPLIRFIGSDDMTQNRELFQVWLQKLAQWHQTTTPYLFLHTPDIAQAPELVHTL
157 -> 167 RVILDSRPVHA
52 -> 53 EQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11824N
ECOCYC:
EG12379-MONOMER
ECOLIWIKI:
b1868
INTERPRO:
IPR036520
INTERPRO:
IPR002763
PANTHER:
PTHR30348
PFAM:
PF01904
PRIDE:
P37348
REFSEQ:
NP_416382
SMR:
P37348
UNIPROT:
P37348


Operon      
Name: yecDE         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2214 1949007 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2215 1949515 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2216 (cluster) 1950222 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2217 1950276 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2218 1950278 reverse nd [RS-EPT-CBR] [1]
  promoter yecDp8 1950636 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yecDp7 1950760 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yecDp4 1950778 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2220 1950822 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB