RegulonDB RegulonDB 10.7: Gene Form
   

gntT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

malQ gntT nfuA GntR GntR CRP TSS_4013 TSS_4013 gntTp3 gntTp3 gntTp2 gntTp2 gntTp1 gntTp1

Gene      
Name: gntT    Texpresso search in the literature
Synonym(s): ECK3402, EG12380, b3415, gntM, gntTalpha, usgA, yhgC
Genome position(nucleotides): 3546559 --> 3547875 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.38
External database links:  
ASAP:
ABE-0011148
CGSC:
668
ECHOBASE:
EB2282
OU-MICROARRAY:
b3415
PORTECO:
gntT
REGULONDB:
b3415
STRING:
511145.b3415
M3D: gntT
COLOMBOS: gntT
PortEco: b3415


Shine dalgarno      
Sequence: acaaatgaaaGGCCAGgtaaatcATG


Product      
Name: high-affinity gluconate transporter
Synonym(s): GntM, GntT, UsgA, YhgC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 45.967
Isoelectric point: 8.448
Motif(s):
 
Type Positions Sequence
1 -> 437 MPLVIVAIGVILLLLLMIRFKMNGFIALVLVALAVGLMQGMPLDKVIGSIKAGVGGTLGSLALIMGFGAMLGKMLADCGGAQRIATTLIAKFGKKHIQWAVVLTGFTVGFALFYEVGFVLMLPLVFTIAASANIPLLYVGVPMAAALSVTHGFLPPHPGPTAIATIFNADMGKTLLYGTILAIPTVILAGPVYARVLKGIDKPIPEGLYSAKTFSEEEMPSFGVSVWTSLVPVVLMAMRAIAEMILPKGHAFLPVAEFLGDPVMATLIAVLIAMFTFGLNRGRSMDQINDTLVSSIKIIAMMLLIIGGGGAFKQVLVDSGVDKYIASMMHETNISPLLMAWSIAAVLRIALGSATVAAITAGGIAAPLIATTGVSPELMVIAVGSGSVIFSHVNDPGFWLFKEYFNLTIGETIKSWSMLETIISVCGLVGCLLLNMV
52 -> 72 AGVGGTLGSLALIMGFGAMLG
327 -> 347 SMMHETNISPLLMAWSIAAVL
23 -> 43 NGFIALVLVALAVGLMQGMPL
55 -> 58 GGTL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015128 - gluconate transmembrane transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0019521 - D-gluconate metabolic process
GO:0046177 - D-gluconate catabolic process
GO:0035429 - gluconate transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
GNTT-MONOMER
ECOLIWIKI:
b3415
INTERPRO:
IPR003474
PANTHER:
PTHR30354
PFAM:
PF02447
PRIDE:
P39835
PROTEINMODELPORTAL:
P39835
REFSEQ:
YP_026217
UNIPROT:
P39835


Operon      
Name: gntT         
Operon arrangement:
Transcription unit        Promoter
gntT
gntT
gntT


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: GntR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4013 3547786 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB