RegulonDB RegulonDB 10.8: Gene Form
   

nrdF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nrdE proV nrdF nrdI proW H-NS H-NS IHF H-NS H-NS H-NS H-NS H-NS H-NS H-NS IHF H-NS terminator anti-terminator TSS_2992 TSS_2992 proVp3 proVp3 proVp2 proVp2 proVp1 proVp1

Gene      
Name: nrdF    Texpresso search in the literature
Synonym(s): ECK2670, EG12381, b2676, ygaD
Genome position(nucleotides): 2803502 --> 2804461 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.23
External database links:  
ASAP:
ABE-0008808
ECHOBASE:
EB2283
OU-MICROARRAY:
b2676
PortEco:
nrdF
STRING:
511145.b2676
COLOMBOS: nrdF


Product      
Name: ribonucleoside-diphosphate reductase 2 subunit β
Synonym(s): NrdF, YgaD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.443
Isoelectric point: 4.406
Motif(s):
 
Type Positions Sequence
9 -> 280 INWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLTVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKNMEKISLGQREELKSFAFDLLLELYDNELQYTDELYAETPWADDVKAFLCYNANKALMNLGYEPLFPAEMAEVNP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005971 - ribonucleoside-diphosphate reductase complex
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004748 - ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor
GO:0005506 - iron ion binding
GO:0030145 - manganese ion binding
biological_process GO:0006260 - DNA replication
GO:0009263 - deoxyribonucleotide biosynthetic process
GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-374N
ECOCYC:
NRDF-MONOMER
ECOLIWIKI:
b2676
INTERPRO:
IPR000358
INTERPRO:
IPR033909
INTERPRO:
IPR030475
INTERPRO:
IPR026494
INTERPRO:
IPR012348
INTERPRO:
IPR009078
MODBASE:
P37146
PANTHER:
PTHR23409
PDB:
4M1F
PDB:
3N37
PDB:
3N3B
PDB:
3N38
PDB:
3N39
PDB:
3N3A
PFAM:
PF00268
PRIDE:
P37146
PRODB:
PRO_000023406
PROSITE:
PS00368
REFSEQ:
NP_417162
SMR:
P37146
SWISSMODEL:
P37146
UNIPROT:
P37146


Operon      
Name: nrdHIEF         
Operon arrangement:
Transcription unit        Promoter
nrdHIEF


Transcriptional Regulation      
Display Regulation             
Activated by: IscR
Repressed by: Fur, NrdR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2992 2805036 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB