RegulonDB RegulonDB 10.6.3: Gene Form
   

rcsD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rcsD rcsB micF Lrp Lrp CpxR Lrp Lrp AcrR Lrp TSS_2496 TSS_2496 TSS_2495 TSS_2495 TSS_2494 (cluster) TSS_2494 (cluster) TSS_2493 TSS_2493 TSS_2492 TSS_2492 TSS_2491 TSS_2491 TSS_2490 (cluster) TSS_2490 (cluster) TSS_2489 (cluster) TSS_2489 (cluster) rcsBp2 rcsBp2 rcsBp1 rcsBp1 rcsDp rcsDp micFp micFp

Gene      
Name: rcsD    Texpresso search in the literature
Synonym(s): ECK2209, EG12385, b2216, yojN, yojP, yojQ
Genome position(nucleotides): 2313488 --> 2316160 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.38
External database links:  
ASAP:
ABE-0007330
ECHOBASE:
EB2286
ECOCYC:
EG12385
ECOLIHUB:
rcsD
OU-MICROARRAY:
b2216
REGULONDB:
b2216
STRING:
511145.b2216
M3D: rcsD
COLOMBOS: rcsD
PortEco: b2216


Product      
Name: RcsD phosphotransferase
Synonym(s): RcsD, YojN, YojP, YojQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 100.372
Isoelectric point: 4.838
Motif(s):
 
Type Positions Sequence
267 -> 267 T
565 -> 676 GDRDALRRILLLLMQYAVTSTQLGKITLEVDQDESSEDRLTFRILDTGEGVSIHEMDNLHFPFINQTQNDRYGKADPLAFWLSDQLARKLGGHLNIKTRDGLGTRYSVHIKM
811 -> 868 YALFVDTVPDDVKRLYTEAATSDFAALAQTAHRLKGVFAMLNLVPGKQLCETLEHLIR
184 -> 184 A
468 -> 678 NIGDALKEPAQSLAESAAKLNAPESKQLANQADVLVRLVDEIQLANMLADDSWKSETVLFSVQDLIDEVVPSVLPAIKRKGLQLLINNHLKAHDMRRGDRDALRRILLLLMQYAVTSTQLGKITLEVDQDESSEDRLTFRILDTGEGVSIHEMDNLHFPFINQTQNDRYGKADPLAFWLSDQLARKLGGHLNIKTRDGLGTRYSVHIKMLA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0016774 - phosphotransferase activity, carboxyl group as acceptor
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0009927 - histidine phosphotransfer kinase activity
biological_process GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0018106 - peptidyl-histidine phosphorylation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Takeda S., et al., 2001
External database links:  
DIP:
DIP-12815N
ECOCYC:
EG12385-MONOMER
ECOLIWIKI:
b2216
INTERPRO:
IPR036641
INTERPRO:
IPR038616
INTERPRO:
IPR036890
INTERPRO:
IPR032306
INTERPRO:
IPR030861
INTERPRO:
IPR008207
INTERPRO:
IPR005467
INTERPRO:
IPR003594
MINT:
MINT-1304951
MODBASE:
P39838
PDB:
1SR2
PDB:
2KX7
PFAM:
PF01627
PFAM:
PF02518
PFAM:
PF16359
PRIDE:
P39838
PRODB:
PRO_000025054
PROSITE:
PS50894
PROSITE:
PS50109
PROTEINMODELPORTAL:
P39838
REFSEQ:
NP_416720
SMART:
SM00387
SMR:
P39838
UNIPROT:
P39838


Operon      
Name: rcsDB         
Operon arrangement:
Transcription unit        Promoter
rcsDB
rcsB
rcsB


Transcriptional Regulation      
Display Regulation             
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2489 (cluster) 2316062 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2490 (cluster) 2316172 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2491 2316181 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2492 2316184 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2493 2316190 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2494 (cluster) 2316194 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2495 2316231 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2496 2316287 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Takeda S., Fujisawa Y., Matsubara M., Aiba H., Mizuno T., 2001, A novel feature of the multistep phosphorelay in Escherichia coli: a revised model of the RcsC --> YojN --> RcsB signalling pathway implicated in capsular synthesis and swarming behaviour., Mol Microbiol 40(2):440-50

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB