RegulonDB RegulonDB 10.8: Gene Form
   

sfmF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sfmH fimZ sfmF TSS_681 TSS_681

Gene      
Name: sfmF    Texpresso search in the literature
Synonym(s): ECK0527, EG12388, b0534, ybcG
Genome position(nucleotides): 563330 --> 563845 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0001834
ECHOBASE:
EB2289
OU-MICROARRAY:
b0534
PortEco:
sfmF
STRING:
511145.b0534
COLOMBOS: sfmF


Product      
Name: putative fimbrial protein SfmF
Synonym(s): SfmF, YbcG
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 18.223
Isoelectric point: 4.355
Motif(s):
 
Type Positions Sequence
21 -> 171 VDPLGTININLHGNVVDFSCTVNTADIDKTVDLGRWPTTQLLNAGDTTALVPFSLRLEGCPPGSVAILFTGTPASDTNLLALDDPAMAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGVAKADAIFMINYN
1 -> 20 MRRVLFSCFCGLLWSSSGWA
29 -> 171 INLHGNVVDFSCTVNTADIDKTVDLGRWPTTQLLNAGDTTALVPFSLRLEGCPPGSVAILFTGTPASDTNLLALDDPAMAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGVAKADAIFMINYN

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
EG12388-MONOMER
ECOLIWIKI:
b0534
INTERPRO:
IPR008966
INTERPRO:
IPR036937
INTERPRO:
IPR000259
MODBASE:
P38052
PFAM:
PF00419
PRIDE:
P38052
REFSEQ:
NP_415067
SMR:
P38052
UNIPROT:
P38052


Operon      
Name: sfmHF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_681 564377 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB