RegulonDB RegulonDB 10.7: Gene Form
   

ybgE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cydB ybgC ybgE cydX tolQ TSS_889 TSS_889 ybgCp5 ybgCp5 ybgCp6 ybgCp6 ybgEp4 ybgEp4 TSS_888 TSS_888 TSS_887 TSS_887 TSS_886 TSS_886 TSS_885 TSS_885 TSS_884 (cluster) TSS_884 (cluster) TSS_883 TSS_883 TSS_882 TSS_882 TSS_881 TSS_881 TSS_880 TSS_880 TSS_879 TSS_879 TSS_878 TSS_878 TSS_877 TSS_877

Gene      
Name: ybgE    Texpresso search in the literature
Synonym(s): ECK0724, EG12395, b0735
Genome position(nucleotides): 774309 --> 774602 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.66
External database links:  
ASAP:
ABE-0002505
ECHOBASE:
EB2296
OU-MICROARRAY:
b0735
PORTECO:
ybgE
REGULONDB:
b0735
STRING:
511145.b0735
M3D: ybgE
COLOMBOS: ybgE
PortEco: b0735


Product      
Name: PF09600 family protein YbgE
Synonym(s): YbgE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 10.932
Isoelectric point: 8.946
Motif(s):
 
Type Positions Sequence
17 -> 95 LRALSFVMALLLAGCMFWDPSRFAAKTSELEIWHGLLLMWAVCAGVIHGVGFRPQKVLWQGIFCPLLADIVLIVGLIFF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Vanorsdel CE., et al., 2013
External database links:  
ECOCYC:
EG12395-MONOMER
ECOLIWIKI:
b0735
INTERPRO:
IPR011846
PFAM:
PF09600
PRIDE:
P0AAV0
PROTEINMODELPORTAL:
P0AAV0
REFSEQ:
NP_415263
UNIPROT:
P0AAV0


Operon      
Name: cydX-ybgE         
Operon arrangement:
Transcription unit        Promoter
ybgTE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_877 773190 forward nd [RS-EPT-CBR] [2]
  promoter TSS_878 773198 forward nd [RS-EPT-CBR] [2]
  promoter TSS_879 773312 forward nd [RS-EPT-CBR] [2]
  promoter TSS_880 773782 forward nd [RS-EPT-CBR] [2]
  promoter TSS_881 773787 forward nd [RS-EPT-CBR] [2]
  promoter TSS_882 773945 forward nd [RS-EPT-CBR] [2]
  promoter TSS_883 773948 forward nd [RS-EPT-CBR] [2]
  promoter TSS_884 (cluster) 773972 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_885 774006 forward nd [RS-EPT-CBR] [2]
  promoter TSS_886 774011 forward nd [RS-EPT-CBR] [2]
  promoter TSS_887 774017 forward nd [RS-EPT-CBR] [2]
  promoter TSS_888 774033 forward nd [RS-EPT-CBR] [2]
  promoter ybgEp4 774150 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ybgCp6 774644 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ybgCp5 774709 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_889 774711 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Vanorsdel CE., Bhatt S., Allen RJ., Brenner EP., Hobson JJ., Jamil A., Haynes BM., Genson AM., Hemm MR., 2013, The Escherichia coli CydX Protein Is a Member of the CydAB Cytochrome bd Oxidase Complex and Is Required for Cytochrome bd Oxidase Activity., J Bacteriol 195(16):3640-50

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB