RegulonDB RegulonDB 10.7: Gene Form
   

ycbF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pyrD ycbF ycbU ycbV Fis PurR Cis-reg; leader anti-terminator pyrDp pyrDp

Gene      
Name: ycbF    Texpresso search in the literature
Synonym(s): ECK0935, EG12397, b0944
Genome position(nucleotides): 1003947 --> 1004657 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.76
External database links:  
ASAP:
ABE-0003197
ECHOBASE:
EB2298
OU-MICROARRAY:
b0944
PORTECO:
ycbF
REGULONDB:
b0944
STRING:
511145.b0944
M3D: ycbF
COLOMBOS: ycbF
PortEco: b0944


Product      
Name: putative fimbrial chaperone YcbF
Synonym(s): YcbF
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 25.853
Isoelectric point: 10.189
Motif(s):
 
Type Positions Sequence
1 -> 26 MTNTWNRLALLIFAVLSLLVAGELQA
172 -> 228 TNPTPYYINLIQVSVNGKALSNVGVVPPKSQRQTSWCQAIAPCHVAWRAINDYGGLS
27 -> 236 GVVVGGTRFIFPADRESISILLTNTSQESWLINSKINRPTRWAGGEASTVPAPLLAAPPLILLKPGTTGTLRLLRTESDILPVDRETLFELSIASVPSGKVENQSVKVAMRSVFKLFWRPEGLPGDPLEAYQQLRWTRNSQGVQLTNPTPYYINLIQVSVNGKALSNVGVVPPKSQRQTSWCQAIAPCHVAWRAINDYGGLSAKKEQNLP

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0043711 - pilus organization
GO:0071555 - cell wall organization
GO:0061077 - chaperone-mediated protein folding
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Korea CG., et al., 2011
[2] Wurpel DJ., et al., 2013
[3] Zhai Y., et al., 2002
External database links:  
ECOCYC:
EG12397-MONOMER
ECOLIWIKI:
b0944
INTERPRO:
IPR018046
INTERPRO:
IPR013783
INTERPRO:
IPR016147
INTERPRO:
IPR016148
INTERPRO:
IPR001829
INTERPRO:
IPR036316
INTERPRO:
IPR008962
MODBASE:
P40876
PFAM:
PF00345
PFAM:
PF02753
PRIDE:
P40876
PRINTS:
PR00969
PROSITE:
PS00635
PROTEINMODELPORTAL:
P40876
REFSEQ:
NP_415464
SMR:
P40876
UNIPROT:
P40876


Operon      
Name: elfDCG-ycbUVF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [2] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [3] Zhai Y., Saier MH., 2002, The beta-barrel finder (BBF) program, allowing identification of outer membrane beta-barrel proteins encoded within prokaryotic genomes., Protein Sci 11(9):2196-207


RegulonDB