RegulonDB RegulonDB 10.8: Gene Form
   

dhaM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

treA dhaM dhaL TSS_1524 TSS_1524 TSS_1523 TSS_1523 TSS_1522 TSS_1522 TSS_1521 TSS_1521 treAp treAp

Gene      
Name: dhaM    Texpresso search in the literature
Synonym(s): ECK1186, EG12399, b1198, dhaH, ptsD, ycgC
Genome position(nucleotides): 1247696 <-- 1249114 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.18
Reference(s): [1] Gutknecht R., et al., 2001
[2] Paulsen IT., et al., 2000
External database links:  
ASAP:
ABE-0004024
ECHOBASE:
EB2299
OU-MICROARRAY:
b1198
PortEco:
dhaM
STRING:
511145.b1198
COLOMBOS: dhaM


Product      
Name: dihydroxyacetone kinase subunit M
Synonym(s): DhaH, DhaM, PtsD, YcgC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 51.449
Isoelectric point: 4.355
Motif(s):
 
Type Positions Sequence
200 -> 200 S
258 -> 368 GKAFYYQPVLCTVQAKSTLTVEEEQDRLRQAIDFTLLDLMTLTAKAEASGLDDIAAIFSGHHTLLDDPELLAAASELLQHEHCTAEYAWQQVLKELSQQYQQLDDEYLQAR
393 -> 464 FNSPTILLAENIYPSTVLQLDPAVVKGICLSAGSPVSHSALIARELGIGWICQQGEKLYAIQPEETLTLDVK
160 -> 236 VVIKNRNGLHVRPASRLVYTLSTFNADMLLEKNGKCVTPESINQIALLQVRYNDTLRLIAKGPEAEEALIAFRQLAE
4 -> 120 LVIVSHSSRLGEGVGELARQMLMSDSCKIAIAAGIDDPQNPIGTDAVKVMEAIESVADADHVLVMMDMGSALLSAETALELLAPEIAAKVRLCAAPLVEGTLAATVSAASGADIDKV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0047324 - phosphoenolpyruvate-glycerone phosphotransferase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0019563 - glycerol catabolic process
External database links:  
DIP:
DIP-11551N
ECOCYC:
EG12399-MONOMER
ECOLIWIKI:
b1198
INTERPRO:
IPR035895
INTERPRO:
IPR039643
INTERPRO:
IPR036662
INTERPRO:
IPR036637
INTERPRO:
IPR036618
INTERPRO:
IPR012844
INTERPRO:
IPR008731
INTERPRO:
IPR008279
INTERPRO:
IPR004701
INTERPRO:
IPR001020
INTERPRO:
IPR000032
MODBASE:
P37349
PANTHER:
PTHR38594
PFAM:
PF00381
PFAM:
PF00391
PFAM:
PF05524
PFAM:
PF03610
PRIDE:
P37349
PRINTS:
PR00107
PRODB:
PRO_000022440
PROSITE:
PS51096
PROSITE:
PS51350
PROSITE:
PS00369
REFSEQ:
NP_415716
SMR:
P37349
UNIPROT:
P37349


Operon      
Name: dhaKLM         
Operon arrangement:
Transcription unit        Promoter
dhaKLM
dhaM


Transcriptional Regulation      
Display Regulation             
Activated by: DhaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1521 1249121 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1522 1249128 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1523 1249497 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1524 1249736 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gutknecht R., Beutler R., Garcia-Alles LF., Baumann U., Erni B., 2001, The dihydroxyacetone kinase of Escherichia coli utilizes a phosphoprotein instead of ATP as phosphoryl donor., EMBO J 20(10):2480-6

 [2] Paulsen IT., Reizer J., Jin RZ., Lin EC., Saier MH., 2000, Functional genomic studies of dihydroxyacetone utilization in Escherichia coli., Microbiology 146 ( Pt 10):2343-4

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB