RegulonDB RegulonDB 10.7: Gene Form
   

chaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

chaA chaC chaB TSS_1553 TSS_1553 chaCp chaCp TSS_1552 TSS_1552 TSS_1551 TSS_1551 TSS_1550 (cluster) TSS_1550 (cluster) TSS_1549 TSS_1549

Gene      
Name: chaB    Texpresso search in the literature
Synonym(s): ECK1211, EG12402, b1217
Genome position(nucleotides): 1272119 --> 1272349 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.45
External database links:  
ASAP:
ABE-0004087
CGSC:
37193
ECHOBASE:
EB2302
OU-MICROARRAY:
b1217
PORTECO:
chaB
REGULONDB:
b1217
STRING:
511145.b1217
M3D: chaB
COLOMBOS: chaB
PortEco: b1217


Product      
Name: putative cation transport regulator ChaB
Synonym(s): ChaB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.945
Isoelectric point: 7.088
Motif(s):
 
Type Positions Sequence
9 -> 75 LPESVKHVLPSHAQDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWAAVKHEYAKGDDDKWHKK

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47930N
ECOCYC:
EG12402-MONOMER
ECOLIWIKI:
b1217
INTERPRO:
IPR009317
INTERPRO:
IPR037205
PDB:
1SG7
PFAM:
PF06150
PRIDE:
P0AE63
PRODB:
PRO_000022270
PROTEINMODELPORTAL:
P0AE63
REFSEQ:
NP_415735
SMR:
P0AE63
SWISSMODEL:
P0AE63
UNIPROT:
P0AE63


Operon      
Name: chaBC         
Operon arrangement:
Transcription unit        Promoter
chaC
chaBC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1549 1271993 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1550 (cluster) 1272028 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1551 1272095 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1552 1272231 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1553 1272424 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB