RegulonDB RegulonDB 10.7: Gene Form
   

chaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

chaC ychN chaB TSS_1553 TSS_1553 chaCp chaCp TSS_1552 TSS_1552

Gene      
Name: chaC    Texpresso search in the literature
Synonym(s): ECK1212, EG12403, b1218
Genome position(nucleotides): 1272507 --> 1273202 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.74
External database links:  
ASAP:
ABE-0004089
CGSC:
37196
ECHOBASE:
EB2303
OU-MICROARRAY:
b1218
PORTECO:
chaC
REGULONDB:
b1218
STRING:
511145.b1218
M3D: chaC
COLOMBOS: chaC
PortEco: b1218


Product      
Name: glutathione-specific γ-glutamylcyclotransferase
Synonym(s): ChaC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.512
Isoelectric point: 4.609
Motif(s):
 
Type Positions Sequence
15 -> 15 A
79 -> 79 C
47 -> 215 VWIFGYGSLMWNPALEFTESCTGTLVGWHRAFCLRLTAGRGTAHQPGRMLALKEGGRTTGVAYRLPEETLEQELTLLWKREMITGCYLPTWCQLDLDDGRTVNAIVFIMDPRHPEYESDTRAQVIAPLIAAASGPLGTNAQYLFSLEQELIKLGMQDDGLNDLLVSVKK
49 -> 54 IFGYGS

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0061928 - glutathione specific gamma-glutamylcyclotransferase activity
GO:0016829 - lyase activity
GO:0003839 - gamma-glutamylcyclotransferase activity
biological_process GO:0001539 - cilium or flagellum-dependent cell motility
GO:0006751 - glutathione catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12403-MONOMER
ECOLIWIKI:
b1218
INTERPRO:
IPR006840
INTERPRO:
IPR013024
INTERPRO:
IPR036568
PANTHER:
PTHR12192
PFAM:
PF04752
PRIDE:
P39163
PRODB:
PRO_000022271
PROTEINMODELPORTAL:
P39163
REFSEQ:
NP_415736
SMR:
P39163
UNIPROT:
P39163


Operon      
Name: chaBC         
Operon arrangement:
Transcription unit        Promoter
chaC
chaBC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1552 1272231 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1553 1272424 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB