RegulonDB RegulonDB 10.7: Gene Form
   

ychN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ychO chaC ychN ychOp ychOp ychNp4 ychNp4 TSS_1554 TSS_1554

Gene      
Name: ychN    Texpresso search in the literature
Synonym(s): ECK1213, EG12404, b1219
Genome position(nucleotides): 1273246 <-- 1273599 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.69
External database links:  
ASAP:
ABE-0004091
ECHOBASE:
EB2304
OU-MICROARRAY:
b1219
PORTECO:
ychN
REGULONDB:
b1219
STRING:
511145.b1219
M3D: ychN
COLOMBOS: ychN
PortEco: b1219


Product      
Name: DsrE/F sulfur relay family protein YchN
Synonym(s): YchN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.693
Isoelectric point: 4.736
Motif(s):
 
Type Positions Sequence
8 -> 8 A
2 -> 117 QKIVIVANGAPYGSESLFNSLRLAIALREQESNLDLRLFLMSDAVTAGLRGQKPGEGYNIQQMLEILTAQNVPVKLCKTCTDGRGISTLPLIDGVEIGTLVELAQWTLSADKVLTF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48042N
ECOCYC:
EG12404-MONOMER
ECOLIWIKI:
b1219
INTERPRO:
IPR003787
INTERPRO:
IPR027396
MINT:
MINT-1300414
MODBASE:
P0AB52
PDB:
1JX7
PFAM:
PF02635
PRIDE:
P0AB52
PROTEINMODELPORTAL:
P0AB52
REFSEQ:
NP_415737
SMR:
P0AB52
UNIPROT:
P0AB52


Operon      
Name: ychN         
Operon arrangement:
Transcription unit        Promoter
ychN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1554 1273632 reverse nd [RS-EPT-CBR] [1]
  promoter ychNp4 1273655 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB