RegulonDB RegulonDB 10.7: Gene Form
   

ychO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ychO narL ychN narX ychOp ychOp ychNp4 ychNp4 TSS_1554 TSS_1554

Gene      
Name: ychO    Texpresso search in the literature
Synonym(s): ECK1214, EG12405, b1220, ychP
Genome position(nucleotides): 1273784 --> 1275178 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.54
External database links:  
ASAP:
ABE-0004095
ECHOBASE:
EB2305
OU-MICROARRAY:
b1220
PORTECO:
ychO
REGULONDB:
b1220
STRING:
511145.b1220
M3D: ychO
COLOMBOS: ychO
PortEco: b1220


Product      
Name: putative invasin YchO
Synonym(s): YchO, YchP
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane,periplasmic space
Molecular weight: 52.1
Isoelectric point: 4.965
Motif(s):
 
Type Positions Sequence
64 -> 341 KDFGETSMNDNGLDTGEQAKAFALGKVRDALSQQVNQHVESWLSPWGNASVDVKVDNEGHFTGSRGSWFVPLQDNDRYLTWSQLGLTQQDNGLVSNVGVGQRWARGNWLVGYNTFYDNLLDENLQRAGFGAEAWGEYLRLSANFYQPFAAWHEQTATQEQRMARGYDLTARMRMPFYQHLNTSVSLEQYFGDRVDLFNSGTGYHNPVALSLGLNYTPVPLVTVTAQHKQGESGENQNNLGLNLNYRFGVPLKKQLSAGEVAESQSLRGSRYDNPQRNN
25 -> 464 QSTFEQKAANPFDNNNDGLPDLGMAPENHDGEKHFAEIVKDFGETSMNDNGLDTGEQAKAFALGKVRDALSQQVNQHVESWLSPWGNASVDVKVDNEGHFTGSRGSWFVPLQDNDRYLTWSQLGLTQQDNGLVSNVGVGQRWARGNWLVGYNTFYDNLLDENLQRAGFGAEAWGEYLRLSANFYQPFAAWHEQTATQEQRMARGYDLTARMRMPFYQHLNTSVSLEQYFGDRVDLFNSGTGYHNPVALSLGLNYTPVPLVTVTAQHKQGESGENQNNLGLNLNYRFGVPLKKQLSAGEVAESQSLRGSRYDNPQRNNLPTLEYRQRKTLTVFLATPPWDLKPGETVPLKLQIRSRYGIRQLIWQGDTQILSLTPGAQANSAEGWTLIMPDWQNGEGASNHWRLSVVVEDNQGQRVSSNEITLTLVEPFDALSNDELRWEP
1 -> 24 MSRFVPRIIPFYLLLLVAGGTANA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0042597 - periplasmic space
biological_process GO:0009405 - pathogenesis
GO:0030260 - entry into host cell
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12405-MONOMER
ECOLIWIKI:
b1220
INTERPRO:
IPR024519
INTERPRO:
IPR038177
PFAM:
PF11924
PRIDE:
P39165
PROTEINMODELPORTAL:
P39165
REFSEQ:
NP_415738
SMR:
P39165
UNIPROT:
P39165


Operon      
Name: ychO         
Operon arrangement:
Transcription unit        Promoter
ychO


Transcriptional Regulation      
Display Regulation             
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1554 1273632 reverse nd [RS-EPT-CBR] [1]
  promoter ychNp4 1273655 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB