RegulonDB RegulonDB 10.8: Gene Form
   

aegA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aegA narQ nudK CpxR CRP anti-terminator terminator terminator narQp narQp TSS_2756 TSS_2756 TSS_2755 TSS_2755 TSS_2754 TSS_2754 TSS_2753 TSS_2753 TSS_2752 (cluster) TSS_2752 (cluster)

Gene      
Name: aegA    Texpresso search in the literature
Synonym(s): ECK2463, EG12409, b2468, yffG
Genome position(nucleotides): 2583546 <-- 2585525 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.71
External database links:  
ASAP:
ABE-0008127
ECHOBASE:
EB2308
OU-MICROARRAY:
b2468
PortEco:
aegA
STRING:
511145.b2468
COLOMBOS: aegA


Shine dalgarno      
Sequence: caaccaaaaaAGAAGGtcgtTAT


Product      
Name: putative oxidoreductase AegA
Synonym(s): AegA, YffG, putative oxidoreductase Fe-S subunit AegA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 71.844
Isoelectric point: 6.766
Motif(s):
 
Type Positions Sequence
78 -> 107 DSIQVNQQKCIGCKSCVVACPFGTMQIVLT
328 -> 640 KRVAIIGAGPAGLACADVLTRNGVGVTVYDRHPEIGGLLTFGIPSFKLDKSLLARRREIFSAMGIHFELNCEVGKDVSLDSLLEQYDAVFVGVGTYRSMKAGLPNEDAPGVYDALPFLIANTKQVMGLEELPEEPFINTAGLNVVVLGGGDTAMDCVRTALRHGASNVTCAYRRDEANMPGSKKEVKNAREEGANFEFNVQPVALELNEQGHVCGIRFLRTRLGEPDAQGRRRPVPVEGSEFVMPADAVIMAFGFNPHGMPWLESHGVTVDKWGRIIADVESQYRYQTTNPKIFAGGDAVRGADLVVTAMAEG
600 -> 600 W
114 -> 147 VKATAHKCDLCAGRENGPACVENCPADALQLVTD
488 -> 488 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016639 - oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0019628 - urate catabolic process
GO:0006537 - glutamate biosynthetic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
[IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Cavicchioli R., et al., 1996
[2] Iwadate Y., et al., 2019
[3] Li J., et al., 2019
External database links:  
DIP:
DIP-9060N
ECOCYC:
EG12409-MONOMER
ECOLIWIKI:
b2468
INTERPRO:
IPR023753
INTERPRO:
IPR036188
INTERPRO:
IPR028261
INTERPRO:
IPR017900
INTERPRO:
IPR017896
INTERPRO:
IPR009051
INTERPRO:
IPR006006
MODBASE:
P37127
PFAM:
PF14691
PFAM:
PF07992
PFAM:
PF13247
PRIDE:
P37127
PRODB:
PRO_000022062
PROSITE:
PS51379
PROSITE:
PS00198
REFSEQ:
NP_416963
SMR:
P37127
UNIPROT:
P37127


Operon      
Name: aegA         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2752 (cluster) 2582912 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_2753 2582914 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2754 2582916 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2755 2582930 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2756 2583501 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Cavicchioli R., Kolesnikow T., Chiang RC., Gunsalus RP., 1996, Characterization of the aegA locus of Escherichia coli: control of gene expression in response to anaerobiosis and nitrate., J Bacteriol 178(23):6968-74

 [2] Iwadate Y., Kato JI., 2019, Identification of a Formate-Dependent Uric Acid Degradation Pathway in Escherichia coli., J Bacteriol 201(11)

 [3] Li J., Hao H., Dai M., Zhang H., Ning J., Cheng G., Shabbir MAB., Sajid A., Yuan Z., 2019, Resistance and virulence mechanisms of Escherichia coli selected by enrofloxacin in chicken., Antimicrob Agents Chemother

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB