RegulonDB RegulonDB 10.8: Gene Form
   

nudK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aegA ypfG nudK terminator terminator TSS_2756 TSS_2756 TSS_2755 TSS_2755 TSS_2754 TSS_2754 TSS_2753 TSS_2753 TSS_2752 (cluster) TSS_2752 (cluster) ypfGp3 ypfGp3 ypfGp4 ypfGp4 TSS_2751 TSS_2751

Gene      
Name: nudK    Texpresso search in the literature
Synonym(s): ECK2462, EG12410, b2467, yffH
Genome position(nucleotides): 2582903 <-- 2583478 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.61
External database links:  
ASAP:
ABE-0008123
ECHOBASE:
EB2309
OU-MICROARRAY:
b2467
PortEco:
nudK
STRING:
511145.b2467
COLOMBOS: nudK


Product      
Name: GDP-mannose hydrolase
Synonym(s): GDPMK, NudK, YffH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.749
Isoelectric point: 4.584
Motif(s):
 
Type Positions Sequence
86 -> 106 GLLDNDEPEVCIRKEAIEETG
43 -> 180 DRGNGATILLYNTKKKTVVLIRQFRVATWVNGNESGQLIESCAGLLDNDEPEVCIRKEAIEETGYEVGEVRKLFELYMSPGGVTELIHFFIAEYSDNQRANAGGGVEDEDIEVLELPFSQALEMIKTGEIRDGKTVLL
45 -> 163 GNGATILLYNTKKKTVVLIRQFRVATWVNGNESGQLIESCAGLLDNDEPEVCIRKEAIEETGYEVGEVRKLFELYMSPGGVTELIHFFIAEYSDNQRANAGGGVEDEDIEVLELPFSQA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016818 - hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0046872 - metal ion binding
GO:0000287 - magnesium ion binding
GO:0042803 - protein homodimerization activity
GO:0052751 - GDP-mannose hydrolase activity
biological_process GO:0006753 - nucleoside phosphate metabolic process
GO:0019693 - ribose phosphate metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12410-MONOMER
ECOLIWIKI:
b2467
INTERPRO:
IPR000086
INTERPRO:
IPR004385
INTERPRO:
IPR015797
MODBASE:
P37128
PDB:
3O69
PDB:
3O61
PDB:
3O52
PDB:
1VIU
PDB:
3O6Z
PFAM:
PF00293
PRIDE:
P37128
PRODB:
PRO_000023428
PROSITE:
PS51462
REFSEQ:
NP_416962
SMR:
P37128
UNIPROT:
P37128


Operon      
Name: nudK         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2751 2582813 reverse nd [RS-EPT-CBR] [1]
  promoter ypfGp4 2582880 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ypfGp3 2582893 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2752 (cluster) 2582912 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2753 2582914 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2754 2582916 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2755 2582930 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2756 2583501 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB