RegulonDB RegulonDB 10.7: Gene Form
   

gatB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gatC gatD gatA gatB TSS_2413 TSS_2413 TSS_2412 (cluster) TSS_2412 (cluster) TSS_2411 TSS_2411 TSS_2410 TSS_2410 TSS_2409 (cluster) TSS_2409 (cluster) TSS_2408 TSS_2408 TSS_2407 TSS_2407 TSS_2406 (cluster) TSS_2406 (cluster)

Gene      
Name: gatB    Texpresso search in the literature
Synonym(s): ECK2086, EG12415, b2093
Genome position(nucleotides): 2174282 <-- 2174566 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.75
External database links:  
ASAP:
ABE-0006930
CGSC:
714
ECHOBASE:
EB2314
OU-MICROARRAY:
b2093
PORTECO:
gatB
REGULONDB:
b2093
STRING:
511145.b2093
M3D: gatB
COLOMBOS: gatB
PortEco: b2093


Product      
Name: galactitol-specific PTS enzyme IIB component
Synonym(s): EIIB Gat, Enzyme IIB Gat, GatB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.222
Isoelectric point: 6.224
Motif(s):
 
Type Positions Sequence
4 -> 84 KIIVACGGAVATSTMAAEEIKELCQNHNIPVELIQCRVNEIETYMDGVHLICTTAKVDRSFGDIPLVHGMPFISGIGIEAL
59 -> 59 K
76 -> 76 I
1 -> 94 MKRKIIVACGGAVATSTMAAEEIKELCQNHNIPVELIQCRVNEIETYMDGVHLICTTAKVDRSFGDIPLVHGMPFISGIGIEALQNKILTILQG
9 -> 9 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0090563 - protein-phosphocysteine-sugar phosphotransferase activity
GO:0090584 - protein-phosphocysteine-galactitol-phosphotransferase system transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0019402 - galactitol metabolic process
GO:0034219 - carbohydrate transmembrane transport
GO:0015796 - galactitol transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9744N
ECOCYC:
GATB-MONOMER
ECOLIWIKI:
b2093
INTERPRO:
IPR003501
INTERPRO:
IPR036095
INTERPRO:
IPR013011
MINT:
MINT-1222883
PFAM:
PF02302
PRIDE:
P37188
PRODB:
PRO_000022754
PROSITE:
PS51099
PROTEINMODELPORTAL:
P37188
REFSEQ:
NP_416596
SMR:
P37188
SWISSMODEL:
P37188
UNIPROT:
P37188


Operon      
Name: gatYZABCD         
Operon arrangement:
Transcription unit        Promoter
 
gatYZABCD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: ArcA, GatR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2406 (cluster) 2172607 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2407 2174427 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2408 2174431 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2409 (cluster) 2174473 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2410 2174500 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2411 2174704 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2412 (cluster) 2174716 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2413 2174721 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB