RegulonDB RegulonDB 10.8: Gene Form
   

ybiJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybiI ybiJ ybiE

Gene      
Name: ybiJ    Texpresso search in the literature
Synonym(s): ECK0791, EG12422, b0802
Genome position(nucleotides): 837665 <-- 837925 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.57
External database links:  
ASAP:
ABE-0002741
ECHOBASE:
EB2321
OU-MICROARRAY:
b0802
PortEco:
ybiJ
STRING:
511145.b0802
COLOMBOS: ybiJ


Product      
Name: DUF1471 domain-containing protein YbiJ
Synonym(s): YbiJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 8.568
Isoelectric point: 9.048
Motif(s):
 
Type Positions Sequence
23 -> 86 AEPVTASQAQNMNKIGVVSADGASTLDALEAKLAEKAAAAGASGYSITSATNNNKLSGTAVIYK
1 -> 22 MKTINTVVAAMALSTLSFGVFA
34 -> 86 MNKIGVVSADGASTLDALEAKLAEKAAAAGASGYSITSATNNNKLSGTAVIYK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
EG12422-MONOMER
ECOLIWIKI:
b0802
INTERPRO:
IPR010854
INTERPRO:
IPR036275
INTERPRO:
IPR025543
PFAM:
PF07338
PRIDE:
P0AAX3
REFSEQ:
NP_415323
SMR:
P0AAX3
UNIPROT:
P0AAX3


Operon      
Name: ybiJ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056


RegulonDB