RegulonDB RegulonDB 10.7: Gene Form
   

prmC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hemA prfA prmC ychA ychQ kdsAp kdsAp TSS_1548 TSS_1548 TSS_1547 (cluster) TSS_1547 (cluster) ychQp ychQp TSS_1546 TSS_1546 TSS_1545 TSS_1545 TSS_1544 (cluster) TSS_1544 (cluster) TSS_1543 (cluster) TSS_1543 (cluster)

Gene      
Name: prmC    Texpresso search in the literature
Synonym(s): ECK1200, EG12424, b1212, hemK
Genome position(nucleotides): 1266094 --> 1266927 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.16
External database links:  
ASAP:
ABE-0004068
CGSC:
36992
ECHOBASE:
EB2323
OU-MICROARRAY:
b1212
PORTECO:
prmC
REGULONDB:
b1212
STRING:
511145.b1212
M3D: prmC
COLOMBOS: prmC
PortEco: b1212


Product      
Name: protein-(glutamine-N5) methyltransferase
Synonym(s): HemK, PrmC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.975
Isoelectric point: 4.596
Motif(s):
 
Type Positions Sequence
108 -> 243 EQPCRILDLGTGTGAIALALASERPDCEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQSDWFSALAGQQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQG
5 -> 73 HWLREAISQLQASESPRRDAEILLEHVTGRGRTFILAFGETQLTDEQCQQLDALLTRRRDGEPIAHLTG
183 -> 186 NPPY
40 -> 40 L
42 -> 42 F

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0102559 - protein-(glutamine-N5) methyltransferase activity
GO:0003676 - nucleic acid binding
GO:0008168 - methyltransferase activity
GO:0008276 - protein methyltransferase activity
GO:0016740 - transferase activity
GO:0008757 - S-adenosylmethionine-dependent methyltransferase activity
GO:0036009 - protein-glutamine N-methyltransferase activity
biological_process GO:0006479 - protein methylation
GO:0018364 - peptidyl-glutamine methylation
GO:0006415 - translational termination
GO:0032259 - methylation
GO:0010468 - regulation of gene expression
Note(s): Note(s): ...[more].
Reference(s): [1] Roberts RJ. 2004
External database links:  
ECOCYC:
EG12424-MONOMER
ECOLIWIKI:
b1212
INTERPRO:
IPR029063
INTERPRO:
IPR019874
INTERPRO:
IPR025714
INTERPRO:
IPR040758
INTERPRO:
IPR002052
INTERPRO:
IPR004556
MODBASE:
P0ACC1
PANTHER:
PTHR18895:SF83
PDB:
2B3T
PDB:
1T43
PFAM:
PF13847
PFAM:
PF17827
PRIDE:
P0ACC1
PRODB:
PRO_000022877
PROTEINMODELPORTAL:
P0ACC1
REFSEQ:
NP_415730
SMR:
P0ACC1
UNIPROT:
P0ACC1


Operon      
Name: hemA-prfA-prmC         
Operon arrangement:
Transcription unit        Promoter
hemA
hemA-prfA-prmC


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, ArcA
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1543 (cluster) 1264894 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1544 (cluster) 1264899 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1545 1265281 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1546 1265487 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1547 (cluster) 1267181 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1548 1267190 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Roberts RJ., 2004, Identifying protein function--a call for community action., PLoS Biol 2(3):E42

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB