RegulonDB RegulonDB 10.8: Gene Form
   

puuR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

puuC puuD puuR ArcA PuuR CRP puuCp puuCp TSS_1741 TSS_1741

Gene      
Name: puuR    Texpresso search in the literature
Synonym(s): ECK1294, EG12431, b1299, ycjC
Genome position(nucleotides): 1361911 --> 1362468 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.9
External database links:  
ASAP:
ABE-0004371
ECHOBASE:
EB2327
OU-MICROARRAY:
b1299
PortEco:
puuR
STRING:
511145.b1299
COLOMBOS: puuR


Product      
Name: DNA-binding transcriptional repressor PuuR
Synonym(s): PuuR, YcjC
Sequence: Get amino acid sequence Fasta Format
Regulator Family: HTH_3
Cellular location: cytosol
Molecular weight: 20.092
Isoelectric point: 5.232
Motif(s):
 
Type Positions Sequence
12 -> 66 LSEIRQQQGLSQRRAAELSGLTHSAISTIEQDKVSPAISTLQKLLKVYGLSLSEF
13 -> 66 SEIRQQQGLSQRRAAELSGLTHSAISTIEQDKVSPAISTLQKLLKVYGLSLSEF
111 -> 178 FETYQPGTTTGERIKHQGEEIGTVLEGEIVLTINGQDYHLVAGQSYAINTGIPHSFSNTSAGICRIIS
23 -> 42 QRRAAELSGLTHSAISTIEQ

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0009447 - putrescine catabolic process
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Kurihara S., et al., 2005
[2] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-48257N
ECOCYC:
EG12431-MONOMER
ECOLIWIKI:
b1299
INTERPRO:
IPR011051
INTERPRO:
IPR014710
INTERPRO:
IPR013096
INTERPRO:
IPR001387
INTERPRO:
IPR010982
MINT:
MINT-1257910
MODBASE:
P0A9U6
PFAM:
PF01381
PFAM:
PF07883
PRIDE:
P0A9U6
PRODB:
PRO_000023654
PROSITE:
PS50943
REFSEQ:
NP_415815
SMART:
SM00530
SMR:
P0A9U6
UNIPROT:
P0A9U6


Operon      
Name: puuDRCBE         
Operon arrangement:
Transcription unit        Promoter
puuDRCBE
puuCBE


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP, PuuR, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1741 1361667 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kurihara S., Oda S., Kato K., Kim HG., Koyanagi T., Kumagai H., Suzuki H., 2005, A novel putrescine utilization pathway involves gamma-glutamylated intermediates of Escherichia coli K-12., J Biol Chem 280(6):4602-8

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB