RegulonDB RegulonDB 10.8: Gene Form
   

menH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

menD menF menB menH terminator TSS_2521 TSS_2521 TSS_2520 TSS_2520 TSS_2519 (cluster) TSS_2519 (cluster) menBp menBp

Gene      
Name: menH    Texpresso search in the literature
Synonym(s): ECK2257, EG12438, b2263, yfbB
Genome position(nucleotides): 2376834 <-- 2377592 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.13
External database links:  
ASAP:
ABE-0007478
ECHOBASE:
EB2333
OU-MICROARRAY:
b2263
PortEco:
menH
STRING:
511145.b2263
COLOMBOS: menH


Product      
Name: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
Synonym(s): MenH, YfbB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.682
Isoelectric point: 6.415
Motif(s):
 
Type Positions Sequence
210 -> 210 D
176 -> 176 L
17 -> 243 LVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVI
86 -> 86 S
232 -> 232 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016829 - lyase activity
GO:0070205 - 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase activity
biological_process GO:0009234 - menaquinone biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12438-MONOMER
ECOLIWIKI:
b2263
INTERPRO:
IPR000073
INTERPRO:
IPR022485
INTERPRO:
IPR029058
MODBASE:
P37355
PDB:
4MYD
PDB:
4MXD
PDB:
4GEG
PDB:
4GEC
PDB:
4GDM
PDB:
4MYS
PFAM:
PF12697
PRIDE:
P37355
PRODB:
PRO_000023206
REFSEQ:
NP_416766
SMR:
P37355
UNIPROT:
P37355


Operon      
Name: menFDHBCE         
Operon arrangement:
Transcription unit        Promoter
menD-yfbB-menBCE
menBCE
menFD-yfbB-menBCE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter menBp 2376887 reverse nd [AIPP] [1]
  promoter TSS_2519 (cluster) 2376914 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2520 2379245 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2521 2379281 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [AIPP] Automated inference of promoter position

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sharma V., Suvarna K., Meganathan R., Hudspeth ME., 1992, Menaquinone (vitamin K2) biosynthesis: nucleotide sequence and expression of the menB gene from Escherichia coli., J Bacteriol 174(15):5057-62

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB