RegulonDB RegulonDB 10.7: Gene Form
   

yfjD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfjD ypjD grpE terminator anti-terminator anti-anti-terminator terminator TSS_2962 TSS_2962 TSS_2961 TSS_2961 TSS_2960 (cluster) TSS_2960 (cluster)

Gene      
Name: yfjD    Texpresso search in the literature
Synonym(s): ECK2609, EG12442, b2612, b2613, b4461, ypjE
Genome position(nucleotides): 2748774 --> 2750060 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.13
External database links:  
ASAP:
ABE-0174111
ECHOBASE:
EB2336
MIM:
217080
OU-MICROARRAY:
b2613
PORTECO:
yfjD
REGULONDB:
b4461
STRING:
511145.b4461
M3D: yfjD
COLOMBOS: yfjD
PortEco: b2613


Product      
Name: putative inner membrane protein
Synonym(s): YfjD, YpjE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 48.044
Isoelectric point: 5.779
Motif(s):
 
Type Positions Sequence
4 -> 24 ISTTTLIIILIIMVVISAYFS
65 -> 85 LVLIGNNLVNILASALGTIVG
278 -> 326 EIYFVPEGTPLSTQLVKFQRNKKKVGLVVNEYGDIQGLVTVEDILEEIV
130 -> 150 FLLAPLQILMMPLVWLLNAIT
11 -> 184 IILIIMVVISAYFSGSETGMMTLNRYRLRHMAKQGNRSAKRVEKLLRKPDRLISLVLIGNNLVNILASALGTIVGMRLYGDAGVAIATGVLTFVVLVFAEVLPKTIAALYPEKVAYPSSFLLAPLQILMMPLVWLLNAITRMLMRMMGIKTDIVVSGSLSKEELRTIVHESRSQ

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0050660 - flavin adenine dinucleotide binding
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-12070N
ECOCYC:
G7356-MONOMER
ECOLIWIKI:
b4461
INTERPRO:
IPR005170
INTERPRO:
IPR002550
INTERPRO:
IPR000644
INTERPRO:
IPR016169
INTERPRO:
IPR036318
MINT:
MINT-1274766
MODBASE:
P37908
PFAM:
PF03471
PFAM:
PF01595
PFAM:
PF00571
PRIDE:
P37908
PROSITE:
PS51846
PROSITE:
PS51371
PROTEINMODELPORTAL:
P37908
REFSEQ:
YP_026171
SMART:
SM01091
SMR:
P37908
UNIPROT:
P37908


Operon      
Name: yfjD         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2960 (cluster) 2748357 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2961 2748644 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2962 2749213 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB