RegulonDB RegulonDB 10.7: Gene Form
   

yfiL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aroF yfiR yfiL dgcN YjjQ TyrR TyrR TyrR SoxR yfiRp yfiRp yfiRp3 yfiRp3 yfiRp5 yfiRp5 yfiRp6 yfiRp6 yfiRp8 yfiRp8 yfiRp7 yfiRp7 yfiLp10 yfiLp10 yfiLp8 yfiLp8 yfiLp9 yfiLp9 aroFp aroFp TSS_2942 TSS_2942

Gene      
Name: yfiL    Texpresso search in the literature
Synonym(s): ECK2599, EG12446, b2602
Genome position(nucleotides): 2741360 --> 2741725 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.63
External database links:  
ASAP:
ABE-0008565
ECHOBASE:
EB2340
OU-MICROARRAY:
b2602
PORTECO:
yfiL
REGULONDB:
b2602
STRING:
511145.b2602
M3D: yfiL
COLOMBOS: yfiL
PortEco: b2602


Product      
Name: DUF2799 domain-containing lipoprotein YfiL
Synonym(s): YfiL
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.204
Isoelectric point: 4.622
Motif(s):
 
Type Positions Sequence
32 -> 111 DWYDVGMEDAISGSAIKDDDAFSDSQADRGLYLKGYAEGQKKTCQTDFTYARGLSGKSFPASCNNVENASQLHEVWQKGA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12446-MONOMER
ECOLIWIKI:
b2602
INTERPRO:
IPR021242
PFAM:
PF10973
PRIDE:
P11289
PROTEINMODELPORTAL:
P11289
REFSEQ:
NP_417093
UNIPROT:
P11289


Operon      
Name: yfiL         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2942 2740969 reverse nd [RS-EPT-CBR] [1]
  promoter yfiLp9 2741315 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfiLp8 2741347 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfiLp10 2741355 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfiRp7 2741677 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfiRp8 2741702 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfiRp6 2741751 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfiRp5 2741762 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfiRp3 2741822 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB