RegulonDB RegulonDB 10.8: Gene Form
   

ybcH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nfrA ybcH envY nfrB ybcHp4 ybcHp4

Gene      
Name: ybcH    Texpresso search in the literature
Synonym(s): ECK0559, EG12448, b0567
Genome position(nucleotides): 587091 <-- 587981 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.3
External database links:  
ASAP:
ABE-0001937
ECHOBASE:
EB2342
OU-MICROARRAY:
b0567
PortEco:
ybcH
STRING:
511145.b0567
COLOMBOS: ybcH


Product      
Name: DUF4434 domain-containing protein YbcH
Synonym(s): YbcH
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 33.057
Isoelectric point: 8.946
Motif(s):
 
Type Positions Sequence
21 -> 296 MKGIIWQPQNRDSQVTDTQWQGLMSQLRLQGFDTLVLQWTRYGDAFTQPEQRTLLFKRAAAAQQAGLKLIVGLNADPEFFMHQKQSSAALESYLNRLLAADLQQARLWSAAPGITPDGWYISAEIDDLNWRSEAARQPLLTWLNNAQRLISDVSAKPVYISSFFAGNMSPDGYRQLLEHVKATGVNVWVQDGSGVDKLTAEQRERYLQASADCQSPAPASGVVYELFVAGKGKTFTAKPKPDAEIASLLAKRSSCGKDTLYFSLRYLPVAHGILEY
1 -> 20 MRKFIFVLLTLLLVSPFSFA
81 -> 81 A

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12448-MONOMER
ECOLIWIKI:
b0567
INTERPRO:
IPR027849
PFAM:
PF14488
PRIDE:
P37325
REFSEQ:
NP_415099
UNIPROT:
P37325


Operon      
Name: ybcH         
Operon arrangement:
Transcription unit        Promoter
ybcH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybcHp4 588070 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB