RegulonDB RegulonDB 10.8: Gene Form
   

prmB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aroC prmB smrB TSS_2650 TSS_2650 smrBp4 smrBp4 TSS_2649 TSS_2649 smrBp6 smrBp6 TSS_2648 TSS_2648 TSS_2647 (cluster) TSS_2647 (cluster) TSS_2646 TSS_2646

Gene      
Name: prmB    Texpresso search in the literature
Synonym(s): ECK2324, EG12449, b2330, yfcB
Genome position(nucleotides): 2447508 <-- 2448440 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.52
External database links:  
ASAP:
ABE-0007695
ECHOBASE:
EB2343
OU-MICROARRAY:
b2330
PortEco:
prmB
STRING:
511145.b2330
COLOMBOS: prmB


Product      
Name: 50S ribosomal subunit protein L3 N5-glutamine methyltransferase
Synonym(s): PrmB, YfcB, protein-glutamine N-methyltransferase, ribosomal large subunit L3 protein glutamine methyltransferase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.002
Isoelectric point: 4.368
Motif(s):
 
Type Positions Sequence
132 -> 215 QPQHILDMCTGSGCIAIACAYAFPDAEVDAVDISPDALAVAEQNIEEHGLIHNVIPIRSDLFRDLPKVQYDLIVTNPPYVDAED

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0008168 - methyltransferase activity
GO:0008276 - protein methyltransferase activity
GO:0016740 - transferase activity
GO:0008757 - S-adenosylmethionine-dependent methyltransferase activity
GO:0009007 - site-specific DNA-methyltransferase (adenine-specific) activity
GO:0036009 - protein-glutamine N-methyltransferase activity
biological_process GO:0006479 - protein methylation
GO:0018364 - peptidyl-glutamine methylation
GO:0032259 - methylation
GO:0032775 - DNA methylation on adenine
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11976N
ECOCYC:
EG12449-MONOMER
ECOLIWIKI:
b2330
INTERPRO:
IPR002052
INTERPRO:
IPR029063
INTERPRO:
IPR017127
INTERPRO:
IPR007848
INTERPRO:
IPR004556
MINT:
MINT-1267343
MODBASE:
P39199
PFAM:
PF05175
PRIDE:
P39199
REFSEQ:
NP_416833
SMR:
P39199
UNIPROT:
P39199


Operon      
Name: prmB-aroC-mepA-yfcA-epmC-yfcL         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2646 2447511 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2647 (cluster) 2447630 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2648 2448132 reverse nd [RS-EPT-CBR] [1]
  promoter smrBp6 2448436 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2649 2448473 reverse nd [RS-EPT-CBR] [1]
  promoter smrBp4 2448568 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2650 2448581 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB