RegulonDB RegulonDB 10.9: Gene Form
   

ulaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ulaA ulaC ulaB

Gene      
Name: ulaB    Texpresso search in the literature
Synonym(s): ECK4190, EG12494, b4194, sgaB, yjfT
Genome position(nucleotides): 4421393 --> 4421698 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.65
External database links:  
ASAP:
ABE-0013725
ECHOBASE:
EB2387
ECOLIHUB:
ulaB
OU-MICROARRAY:
b4194
STRING:
511145.b4194
COLOMBOS: ulaB


Product      
Name: L-ascorbate specific PTS enzyme IIB component
Synonym(s): SgaB, UlaB, YjfT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.896
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
1 -> 100 MTVRILAVCGNGQGSSMIMKMKVDQFLTQSNIDHTVNSCAVGEYKSELSGADIIIASTHIAGEITVTGNKYVVGVRNMLSPADFGPKLLEVIKEHFPQDV
4 -> 79 RILAVCGNGQGSSMIMKMKVDQFLTQSNIDHTVNSCAVGEYKSELSGADIIIASTHIAGEITVTGNKYVVGVRNML

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0090585 - protein-phosphocysteine-L-ascorbate-phosphotransferase system transporter activity
biological_process GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0015882 - L-ascorbic acid transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Yew WS., et al., 2002
External database links:  
ECOCYC:
YJFT-MONOMER
ECOLIWIKI:
b4194
INTERPRO:
IPR003501
INTERPRO:
IPR013011
INTERPRO:
IPR036095
PFAM:
PF02302
PRIDE:
P69822
PRODB:
PRO_000024176
PROSITE:
PS51099
REFSEQ:
NP_418615
SMR:
P69822
UNIPROT:
P69822


Operon      
Name: ulaABCDEF         
Operon arrangement:
Transcription unit        Promoter
ulaABCDEF


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: IHF, UlaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Yew WS., Gerlt JA., 2002, Utilization of L-ascorbate by Escherichia coli K-12: assignments of functions to products of the yjf-sga and yia-sgb operons., J Bacteriol 184(1):302-6


RegulonDB