RegulonDB RegulonDB 10.9: Gene Form
   

ulaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ulaD ulaC ulaB

Gene      
Name: ulaC    Texpresso search in the literature
Synonym(s): ECK4191, EG12495, b4195, ptxA, sgaA, yjfU
Genome position(nucleotides): 4421708 --> 4422172 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.98
External database links:  
ASAP:
ABE-0013727
ECHOBASE:
EB2388
ECOLIHUB:
ulaC
OU-MICROARRAY:
b4195
STRING:
511145.b4195
COLOMBOS: ulaC


Product      
Name: L-ascorbate specific PTS enzyme IIA component
Synonym(s): EIISga, EIIUla, Enzyme IISga, Enzyme IIUla, PtxA, SgaA, UlaC, YjfU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.238
Isoelectric point: 4.279
Motif(s):
 
Type Positions Sequence
7 -> 148 LAENKSIRLQAEAETWQEAVKIGVDLLVAADVVEPRYYQAILDGVEQFGPYFVIAPGLAMPHGRPEEGVKKTGFSLVTLKKPLEFNHDDNDPVDILITMAAVDANTHQEVGIMQIVNLFEDEENFDRLRACRTEQEVLDLID
153 -> 154 AA
6 -> 150 SLAENKSIRLQAEAETWQEAVKIGVDLLVAADVVEPRYYQAILDGVEQFGPYFVIAPGLAMPHGRPEEGVKKTGFSLVTLKKPLEFNHDDNDPVDILITMAAVDANTHQEVGIMQIVNLFEDEENFDRLRACRTEQEVLDLIDRT

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0090585 - protein-phosphocysteine-L-ascorbate-phosphotransferase system transporter activity
biological_process GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0015882 - L-ascorbic acid transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YJFU-MONOMER
INTERPRO:
IPR002178
INTERPRO:
IPR016152
PFAM:
PF00359
PRIDE:
P69820
PROSITE:
PS51094
PROSITE:
PS00372
REFSEQ:
NP_418616
SMR:
P69820
UNIPROT:
P69820


Operon      
Name: ulaABCDEF         
Operon arrangement:
Transcription unit        Promoter
ulaABCDEF


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: UlaR, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB