RegulonDB RegulonDB 10.9: Gene Form
   

nanX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insG yjhB yjhC NanR NanR NanR anti-anti-terminator anti-terminator terminator yjhCp yjhCp yjhCp2 yjhCp2 yjhBp2 yjhBp2 yjhBp5 yjhBp5 yjhBp4 yjhBp4 yjhBp7 yjhBp7 insGp6 insGp6 TSS_5122 TSS_5122

Gene      
Name: nanX    Texpresso search in the literature
Synonym(s): ECK4269, EG12544, b4279, yjhB
Genome position(nucleotides): 4504058 --> 4505275 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
36.29
External database links:  
ASAP:
ABE-0014025
ECHOBASE:
EB2432
ECOLIHUB:
yjhB
ECOO157CYC:
Z5523
OU-MICROARRAY:
b4279
STRING:
511145.b4279
COLOMBOS: nanX


Product      
Name: sialic acid transporter NanX
Synonym(s): NanX, YjhB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 44.104
Isoelectric point: 9.589
Motif(s):
 
Type Positions Sequence
140 -> 160 ASAFLVSGFSVGNIIAAQIIP
215 -> 235 LSISMIVFLVCFCLFGANWPI
283 -> 303 AFVVGLITSFIFLCPLFFISV
54 -> 74 LIGTVAFIARPIGGGFFGAMA
21 -> 244 WLGYVFDGFDFMMIFYILHIIKADLGITDIQATLIGTVAFIARPIGGGFFGAMADKYGRKPMMMWAIFIYSVGTGLSGIATNLYMLAVCRFIVGLGMSGEYACASTYAVESWPKNLQSKASAFLVSGFSVGNIIAAQIIPQFAEVYGWRNSFFIGLLPVLLVLWIRKSAPESQEWIEDKYKDKSTFLSVFRKPHLSISMIVFLVCFCLFGANWPINGLLPSYLA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0046943 - carboxylic acid transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
biological_process GO:0046942 - carboxylic acid transport
GO:0055085 - transmembrane transport
GO:1905039 - carboxylic acid transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Bell A., et al., 2020
External database links:  
ECOCYC:
YJHB-MONOMER
ECOLIWIKI:
b4279
ECOO157CYC:
Z5523-MONOMER
INTERPRO:
IPR011701
INTERPRO:
IPR020846
INTERPRO:
IPR036259
MODBASE:
P39352
PDB:
4J09
PFAM:
PF07690
PRIDE:
P39352
PROSITE:
PS50850
REFSEQ:
NP_418699
UNIPROT:
P39352


Operon      
Name: nanXY         
Operon arrangement:
Transcription unit        Promoter
yjhBC
yjhC
yjhC


Transcriptional Regulation      
Display Regulation             
Repressed by: NanR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5122 4503457 reverse nd [RS-EPT-CBR] [2]
  promoter insGp6 4503549 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yjhBp7 4503882 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yjhBp4 4504005 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yjhBp5 4504006 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bell A., Severi E., Lee MO., Monaco S., Latousakis D., Angulo J., Thomas GH., Naismith J., Juge N., 2020, Uncovering a novel molecular mechanism for scavenging sialic acids in bacteria., J Biol Chem

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB