RegulonDB RegulonDB 10.7: Gene Form
   

yjjX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ytjC yjjX trpR rob yjjXp6 yjjXp6 yjjXp5 yjjXp5 TSS_5181 TSS_5181 TSS_5180 (cluster) TSS_5180 (cluster)

Gene      
Name: yjjX    Texpresso search in the literature
Synonym(s): ECK4386, EG12600, b4394
Genome position(nucleotides): 4633233 <-- 4633745 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.14
External database links:  
ASAP:
ABE-0014411
ECHOBASE:
EB2485
OU-MICROARRAY:
b4394
PORTECO:
yjjX
REGULONDB:
b4394
STRING:
511145.b4394
M3D: yjjX
COLOMBOS: yjjX
PortEco: b4394


Product      
Name: ITPase/XTPase
Synonym(s): YjjX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.213
Isoelectric point: 6.008
Motif(s):
 
Type Positions Sequence
7 -> 165 ATTNPAKIQAILQAFHEIFGEGSCHIASVAVESGVPEQPFGSEETRAGARNRVANARRLLPEADFWVAIEAGIDGDSTFSWVVIENASQRGEARSATLPLPAVILEKVREGEALGPVMSRYTGIDEIGRKEGAIGVFTAGKLTRASVYHQAVILALSPF
68 -> 69 EA
8 -> 13 TTNPAK
146 -> 152 GKLTRAS

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0017111 - nucleoside-triphosphatase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
biological_process GO:0009117 - nucleotide metabolic process
GO:0006772 - thiamine metabolic process
GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12663N
ECOCYC:
EG12600-MONOMER
ECOLIWIKI:
b4394
INTERPRO:
IPR026533
INTERPRO:
IPR002786
INTERPRO:
IPR029001
PDB:
1U5W
PFAM:
PF01931
PRIDE:
P39411
PROTEINMODELPORTAL:
P39411
REFSEQ:
NP_418811
SMR:
P39411
UNIPROT:
P39411


Operon      
Name: yjjX         
Operon arrangement:
Transcription unit        Promoter
yjjX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5180 (cluster) 4633755 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_5181 4633764 reverse nd [RS-EPT-CBR] [1]
  promoter yjjXp5 4633773 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]
  promoter yjjXp6 4633899 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB