RegulonDB RegulonDB 10.8: Gene Form
   

fabF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fabF pabC acpP terminator anti-terminator anti-anti-terminator pabCp1 pabCp1 pabCp5 pabCp5 pabCp8 pabCp8 TSS_1417 TSS_1417 TSS_1416 (cluster) TSS_1416 (cluster) TSS_1415 (cluster) TSS_1415 (cluster) TSS_1414 TSS_1414 TSS_1413 (cluster) TSS_1413 (cluster) TSS_1412 TSS_1412 TSS_1411 TSS_1411 TSS_1410 TSS_1410

Gene      
Name: fabF    Texpresso search in the literature
Synonym(s): ECK1081, EG12606, b1095, cvc, fabJ, vtr, vtrB
Genome position(nucleotides): 1151939 --> 1153180 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.3
Reference(s): [1] Edwards P., et al., 1997
[2] Magnuson K., et al., 1995
External database links:  
ASAP:
ABE-0003705
CGSC:
795
ECHOBASE:
EB2490
OU-MICROARRAY:
b1095
PortEco:
fabF
STRING:
511145.b1095
COLOMBOS: fabF


Product      
Name: β-ketoacyl-[acyl carrier protein] synthase II
Synonym(s): beta;-ketoacyl-ACP synthase II, Cvc, FabF, FabJ, Vtr, VtrB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 43.046
Isoelectric point: 6.008
Motif(s):
 
Type Positions Sequence
2 -> 413 SKRRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCEDIISRKEQRKMDAFIQYGIVAGVQAMQDSGLEITEENATRIGAAIGSGIGGLGLIEENHTSLMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTRNDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPENGAGAALAMANALRDAGIEASQIGYVNAHGTSTPAGDKAEAQAVKTIFGEAASRVLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPDEGCDLDFVPHEARQVSGMEYTLCNSFGFGGTNGSLIFKKI
4 -> 247 RRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCEDIISRKEQRKMDAFIQYGIVAGVQAMQDSGLEITEENATRIGAAIGSGIGGLGLIEENHTSLMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTRNDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHA
255 -> 369 YAELVGFGMSSDAYHMTSPPENGAGAALAMANALRDAGIEASQIGYVNAHGTSTPAGDKAEAQAVKTIFGEAASRVLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
GO:0004315 - 3-oxoacyl-[acyl-carrier-protein] synthase activity
GO:0042803 - protein homodimerization activity
GO:0033817 - beta-ketoacyl-acyl-carrier-protein synthase II activity
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0006633 - fatty acid biosynthetic process
External database links:  
DIP:
DIP-29377N
ECOCYC:
3-OXOACYL-ACP-SYNTHII-MONOMER
ECOLIWIKI:
b1095
INTERPRO:
IPR020841
INTERPRO:
IPR018201
INTERPRO:
IPR017568
INTERPRO:
IPR016039
INTERPRO:
IPR014031
INTERPRO:
IPR014030
INTERPRO:
IPR000794
MINT:
MINT-1231688
PANTHER:
PTHR11712
PDB:
3HO2
PDB:
3HO9
PDB:
3I8P
PDB:
3HNZ
PDB:
3G0Y
PDB:
3G11
PDB:
1B3N
PDB:
2GFY
PDB:
2GFX
PDB:
2GFW
PDB:
2GFV
PDB:
1KAS
PFAM:
PF00109
PFAM:
PF02801
PRIDE:
P0AAI5
PRODB:
PRO_000022562
PROSITE:
PS00606
REFSEQ:
NP_415613
SMART:
SM00825
SMR:
P0AAI5
UNIPROT:
P0AAI5


Operon      
Name: yceD-rpmF-plsX-fabHDG-acpP-fabF         
Operon arrangement:
Transcription unit        Promoter
yceD-rpmF
yceD-rpmF
rpmF-plsX-fabHDG
plsX-fabHDG
fabHDG
acpP
acpP-fabF
fabDG-acpP
fabF
fabG-acpP


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1410 1151645 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1411 1151715 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1412 1151724 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1413 (cluster) 1151764 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_1414 1151773 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1415 (cluster) 1151777 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_1416 (cluster) 1152105 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_1417 1152173 forward nd [RS-EPT-CBR] [3]
  promoter pabCp8 1153093 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter pabCp5 1153194 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter pabCp1 1153293 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Edwards P., Nelsen JS., Metz JG., Dehesh K., 1997, Cloning of the fabF gene in an expression vector and in vitro characterization of recombinant fabF and fabB encoded enzymes from Escherichia coli., FEBS Lett 402(1):62-6

 [2] Magnuson K., Carey MR., Cronan JE., 1995, The putative fabJ gene of Escherichia coli fatty acid synthesis is the fabF gene., J Bacteriol 177(12):3593-5

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB